Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G54690 179 / 7e-59 HTA3 ,G-H2AX ,GAMMA-H2AX ,H2AXB histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) AT1G08880 177 / 2e-58 HTA5 ,G-H2AX ,GAMMA-H2AX ,H2AXA histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) AT4G27230 162 / 2e-52 HTA2 histone H2A 2 (.1.2) AT5G54640 161 / 5e-52 ATHTA1, HTA1, RAT5 RESISTANT TO AGROBACTERIUM TRANSFORMATION 5, histone H2A 1, Histone superfamily protein (.1) AT1G51060 156 / 3e-50 HTA10 histone H2A 10 (.1) AT3G20670 154 / 2e-49 HTA13 histone H2A 13 (.1) AT5G59870 135 / 1e-41 HTA6 histone H2A 6 (.1) AT5G02560 128 / 8e-39 HTA12 histone H2A 12 (.1.2) AT5G27670 126 / 6e-38 HTA7 histone H2A 7 (.1) AT1G52740 88 / 3e-23 HTA9 histone H2A protein 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039691 [exp] 191 / 1e-63 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10027154 [exp] 191 / 1e-63 AT1G54690 249 / 1e-86 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10003750 [exp] 168 / 2e-54 AT1G54690 239 / 7e-83 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Lus10042960 [exp] 166 / 5e-54 AT1G51060 243 / 2e-84 histone H2A 10 (.1) Lus10028044 [exp] 166 / 6e-54 AT1G08880 238 / 4e-82 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Lus10032464 [exp] 164 / 3e-53 AT1G51060 240 / 2e-83 histone H2A 10 (.1) Lus10004945 [exp] 134 / 3e-41 AT5G02560 233 / 5e-80 histone H2A 12 (.1.2) Lus10040853 [exp] 134 / 6e-41 AT5G02560 228 / 4e-78 histone H2A 12 (.1.2) Lus10005892 [exp] 134 / 7e-41 AT5G02560 230 / 1e-78 histone H2A 12 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G028900 [exp] 181 / 1e-59 AT1G54690 220 / 4e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040800 [exp] 180 / 2e-59 AT1G54690 221 / 2e-75 histone H2A 3, GAMMA H2AX, gamma histone variant H2AX (.1) Potri.005G040700 [exp] 171 / 7e-56 AT1G08880 183 / 2e-60 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.013G028800 [exp] 160 / 2e-51 AT1G08880 190 / 2e-63 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.011G131400 [exp] 159 / 2e-51 AT1G51060 200 / 1e-67 histone H2A 10 (.1) Potri.001G415700 [exp] 160 / 5e-51 AT1G51060 174 / 1e-56 histone H2A 10 (.1) Potri.004G031300 [exp] 157 / 2e-50 AT1G08880 150 / 6e-48 histone H2A 5, gamma histone variant H2AX, GAMMA H2AX, Histone superfamily protein (.1) Potri.006G082300 [exp] 134 / 3e-41 AT5G02560 143 / 2e-44 histone H2A 12 (.1.2) Potri.013G018200 [exp] 131 / 6e-40 AT5G27670 160 / 4e-51 histone H2A 7 (.1) Potri.005G026500 [exp] 129 / 5e-39 AT5G27670 145 / 2e-45 histone H2A 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10002253 pacid=23153437 polypeptide=Lus10002253 locus=Lus10002253.g ID=Lus10002253.BGIv1.0 annot-version=v1.0 ATGAGTTCAGCCGCCGCTGGATCAACCAAGGGAGGCCGAGGCAAGGGCAAAACCACCAAATCCGTCTCCAGATCCTCTAAGGCCGGATTGCAGTTCCCCG TCGGTAGAATCGCCAGGTTCCTCAAGGCCGGCAAGTACGCTGAGCGCGTCGGCGCCGGTGCTCCCGTCTACCTCTCCGCCGTCCTCGAGTACCTCGCCGC TGAGGTTCTGGAGCTGGCCGGAAACGCTGCGAGAGACAACAAGAAGAACAGGATCGTCCCACGGCACATCCAGTTGGCGGTGAGGAACGAAGAGGAGGTG AGCAAGCTGCTTGGATCAGTGACGATCACCAACGGAGGTGTTCTCCCCAACATCCACAACACTCTTCTGCCCAAGAAGGCTGGAACGAAAGGCGACATCG GATCTGCTTCACAAGAGTTTTAA
AA sequence Show only first row Show all	>Lus10002253 pacid=23153437 polypeptide=Lus10002253 locus=Lus10002253.g ID=Lus10002253.BGIv1.0 annot-version=v1.0 MSSAAAGSTKGGRGKGKTTKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNEEEV SKLLGSVTITNGGVLPNIHNTLLPKKAGTKGDIGSASQEF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G54690		HTA3 ,G-H2AX ,G...	histone H2A 3, GAMMA H2AX, gam...		Lus10002253 [exp]	0	1
AT5G59690			Histone superfamily protein (....		Lus10014264 [exp]	3.3	0.9525
AT5G49010		EMB2812, SLD5	SYNTHETIC LETHALITY WITH DPB11...		Lus10017669 [exp]	3.9	0.9425
AT1G09200			Histone superfamily protein (....		Lus10005271 [exp]	5.8	0.9503
AT3G53730			Histone superfamily protein (....		Lus10038481 [exp]	7.3	0.9477
AT2G28740		HIS4	histone H4 (.1)		Lus10025964 [exp]	7.5	0.9373
AT5G65360			Histone superfamily protein (....		Lus10025439 [exp]	8.7	0.9428
AT5G10400			Histone superfamily protein (....		Lus10031822 [exp]	11.0	0.9409
AT5G40030			Protein kinase superfamily pro...		Lus10032185 [exp]	13.4	0.9352
AT1G14900		HMGA	high mobility group A (.1)		Lus10002284 [exp]	17.0	0.9372
AT3G48710			DEK domain-containing chromati...		Lus10022439 [exp]	18.2	0.9049

Compare expression of checked genes

Lus10002253 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.