Lus10002264 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35680 190 / 3e-63 Nucleic acid-binding, OB-fold-like protein (.1.2.3)
AT2G04520 189 / 1e-62 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000920 198 / 2e-66 AT2G04520 252 / 1e-87 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10033806 196 / 1e-65 AT2G04520 254 / 1e-88 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10014627 196 / 1e-65 AT2G04520 254 / 1e-88 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10020713 130 / 9e-40 AT2G04520 169 / 4e-55 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10029827 129 / 6e-39 AT2G04520 168 / 9e-55 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10042438 90 / 7e-24 AT2G04520 100 / 5e-28 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10034249 43 / 1e-05 AT2G40780 197 / 4e-65 Nucleic acid-binding, OB-fold-like protein (.1.2)
Lus10029014 42 / 5e-05 AT2G40780 199 / 4e-66 Nucleic acid-binding, OB-fold-like protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G219200 195 / 4e-65 AT2G04520 198 / 2e-66 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.014G160900 192 / 6e-64 AT2G04520 200 / 3e-67 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.002G031700 160 / 2e-51 AT2G04520 176 / 1e-57 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.014G093801 79 / 2e-20 AT2G04520 76 / 2e-19 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF01176 eIF-1a Translation initiation factor 1A / IF-1
Representative CDS sequence
>Lus10002264 pacid=23153449 polypeptide=Lus10002264 locus=Lus10002264.g ID=Lus10002264.BGIv1.0 annot-version=v1.0
ATGCCGAAGAACAAAGGAAAAGGAGGAAAGAACAGGAAGAGAGGAAAGAACGAGGCTGATGATGAGAAGCGCGAGCTGATCTTCAAGGAAGACGGACAGG
AGTACGCTCAGGTGATGCGAATGCTCGGGAACGGACGATGCGAGGTCACTTGCATCGATGGGGTGAAACGCCTGAGCCATATCCGCGGAAAAATGCACAA
GAAGGTCTGGATCGCGGCTGGTGACATAATCCTTGTAGGGCTGAGGGATTATCAAGATGACAAGGCTGATGTCATCCTAAAGTACATGCCTGATGAGGCC
AGGCTTCTCAAGGCGTATGGCGAGTTGCCAGAGAATATCCGTCTCAACGAGGGTATTGCTGGTGGTCTTGATGAGGAGGATGATGGCGCTGGTGATGACT
ACATCGAGTTTGAAGACGAAGATATCGACAAGATCTAA
AA sequence
>Lus10002264 pacid=23153449 polypeptide=Lus10002264 locus=Lus10002264.g ID=Lus10002264.BGIv1.0 annot-version=v1.0
MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVMRMLGNGRCEVTCIDGVKRLSHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEA
RLLKAYGELPENIRLNEGIAGGLDEEDDGAGDDYIEFEDEDIDKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G04520 Nucleic acid-binding, OB-fold-... Lus10002264 0 1
AT5G09260 VPS20.2 vacuolar protein sorting-assoc... Lus10037699 1.4 0.9073
AT5G04260 WCRKC2 WCRKC thioredoxin 2 (.1) Lus10038703 1.4 0.9040
AT1G66240 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.... Lus10028859 2.4 0.9027
AT5G49230 HRB1 HYPERSENSITIVE TO RED AND BLUE... Lus10017097 3.5 0.8883
AT1G25682 Family of unknown function (DU... Lus10034268 5.7 0.8756
AT5G04000 unknown protein Lus10042034 6.0 0.8588
AT1G68090 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5... Lus10037992 7.4 0.8863
AT5G40370 GRXC2 glutaredoxin C2, Glutaredoxin ... Lus10022253 8.8 0.8682
AT4G39235 unknown protein Lus10004160 10.0 0.8488
AT3G26980 MUB4 membrane-anchored ubiquitin-fo... Lus10035184 10.2 0.8813

Lus10002264 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.