Lus10002266 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07172 GRP Glycine rich protein family
Representative CDS sequence
>Lus10002266 pacid=23153429 polypeptide=Lus10002266 locus=Lus10002266.g ID=Lus10002266.BGIv1.0 annot-version=v1.0
ATGGCATCTTCAAAGACTCTTCTTTTCCTTCTGTTTGCTCTCTTTGCTCTTGTTCTCATTGTTTCTGCTGAAGTCTCCTCCACCACTTCCACGAGTGGTG
ATGAAGTGAAAGGTGCGGACCAATACAGAGGAGGAGGCGGCGGCGGTGACTATCCTGGCCGTGGAGGAGGCGGCGGTGGTGACTATCCTGGCCGTGGAGG
TGGACGCGGTGGTGGCCACCCTGGCCGTGGAGGAGGAGGCGGTGGAAGGTGCTACTACGGTTGTTGCAGAGGGTACCGTTACTCGTACGGATGCAAAAAG
TGTTGCGCCCATGCTAATGAGGCTCCTGATGCTTTCTTCGAGGACGATGTCAAGAACTAG
AA sequence
>Lus10002266 pacid=23153429 polypeptide=Lus10002266 locus=Lus10002266.g ID=Lus10002266.BGIv1.0 annot-version=v1.0
MASSKTLLFLLFALFALVLIVSAEVSSTTSTSGDEVKGADQYRGGGGGGDYPGRGGGGGGDYPGRGGGRGGGHPGRGGGGGGRCYYGCCRGYRYSYGCKK
CCAHANEAPDAFFEDDVKN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002266 0 1
AT2G36830 TIP1;1, GAMMA-T... TONOPLAST INTRINSIC PROTEIN 1;... Lus10014411 1.7 0.9630
AT3G47870 AS2 ASL29, SCP, LBD... SIDECAR POLLEN, ASYMMETRIC LEA... Lus10036665 2.4 0.9476
Lus10008816 5.1 0.9622
AT3G09870 SAUR-like auxin-responsive pro... Lus10004014 6.0 0.9503
AT1G62940 ACOS5 acyl-CoA synthetase 5 (.1) Lus10025842 6.7 0.9339
AT4G37070 AtPLAIVA, PLP1,... phospholipase A IVA, Acyl tran... Lus10000279 7.9 0.9513
AT1G74910 ADP-glucose pyrophosphorylase ... Lus10015338 8.9 0.8626
AT5G43745 Protein of unknown function (D... Lus10039407 10.4 0.9321
AT4G37070 AtPLAIVA, PLP1,... phospholipase A IVA, Acyl tran... Lus10019637 10.5 0.9500
AT5G28010 Polyketide cyclase/dehydrase a... Lus10039891 11.0 0.9436

Lus10002266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.