Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35732 51 / 1e-09 unknown protein AT2G04795 42 / 6e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001730 [exp] 158 / 2e-51 AT5G35732 50 / 6e-09 unknown protein Lus10006404 [exp] 82 / 2e-21 AT5G35732 82 / 1e-21 unknown protein Lus10012359 [exp] 74 / 1e-17 AT5G35732 / unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G222900 [exp] 59 / 1e-12 AT5G35732 102 / 2e-29 unknown protein Potri.014G162400 [exp] 51 / 3e-09 AT5G35732 96 / 5e-27 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002270 pacid=23153445 polypeptide=Lus10002270 locus=Lus10002270.g ID=Lus10002270.BGIv1.0 annot-version=v1.0 ATGTTTCGAACGTTGACAAGACTACGACGAGACACAAGGAAGAGCCCTAGGGTGGCCGACGAGACCACATCGGGAGGGATGATCGTGACTAGAGTTGGTG GTACTGGTGATCATCAATGTCAACAACAACAACTACCCCCAGTAGTTCACACCACGTTGAACAAGTTCATGACCACGGTTGTGAGCCAAGTCTTACTACC CTTCTCGTGCTTGTCTCAACCTCGTGTTAATATGACCGATCGTATGTGGGCATCGATGGAGGTGACACGATCGGCGGAGGTCAACAACCATGACATGGTG AATGATAGCATGAGGTATGCCATACCTATATGTAGTATGTAG
AA sequence Show only first row Show all	>Lus10002270 pacid=23153445 polypeptide=Lus10002270 locus=Lus10002270.g ID=Lus10002270.BGIv1.0 annot-version=v1.0 MFRTLTRLRRDTRKSPRVADETTSGGMIVTRVGGTGDHQCQQQQLPPVVHTTLNKFMTTVVSQVLLPFSCLSQPRVNMTDRMWASMEVTRSAEVNNHDMV NDSMRYAIPICSM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G35732			unknown protein		Lus10002270 [exp]	0	1
AT5G40370		GRXC2	glutaredoxin C2, Glutaredoxin ...		Lus10022253 [exp]	3.5	0.8518
AT2G11520		CRCK3	calmodulin-binding receptor-li...		Lus10028347 [exp]	16.0	0.7785
AT3G13970		APG12B, APG12	AUTOPHAGY 12 B, AUTOPHAGY 12, ...		Lus10000432 [exp]	18.7	0.8082
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10002264 [exp]	21.5	0.7804
AT3G66654			Cyclophilin-like peptidyl-prol...		Lus10021052 [exp]	22.2	0.7643
AT3G50360		CEN1, ATCEN2	CENTRIN 1, centrin2 (.1)		Lus10009353 [exp]	29.2	0.7684
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Lus10021300 [exp]	38.8	0.7563
AT5G46030			unknown protein		Lus10025438 [exp]	41.6	0.7534
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Lus10024638 [exp]	41.7	0.7692
AT4G03115			Mitochondrial substrate carrie...		Lus10009777 [exp]	43.2	0.7576

Compare expression of checked genes

Lus10002270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.