Lus10002303 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002304 65 / 1e-13 ND /
Lus10026075 50 / 5e-08 ND /
Lus10024072 42 / 2e-05 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10002303 pacid=23180876 polypeptide=Lus10002303 locus=Lus10002303.g ID=Lus10002303.BGIv1.0 annot-version=v1.0
ATGGCATATTTTTCTCGTAGAAACATAACGGCAGTAATCGCTGGGATGATGCTGACCGTGTTCCTCGTCGCCGGCAAGTTTCGTCGTCCTTCCGCCACCA
TGGCCAGATCAGTATTTGATGGATTTGTAGCATCAACGTGTATTCCGAACACAATAACCGACAGCAATCTGGCGTCCAGTATAACGGAGGTCAACGATTA
TCTGGTCCACAACACGCCTTCCCATCCCGAGTTCCTGCTTCGGACGCACGCCGTCACTGACGGCGTCACCGCCTACGGCTACGCTTATTGTTATTGGCCG
GGGAAGTCTTGCACCTCTTGTCTTAATGGGCTTGTGGATTACGTTGGGACGAATTGCAAAAATGCTACGCAAGCTGACCTCAGCTCCACTTATTGTTACT
TGAAATACAGTCCCAATCCGGTTTAA
AA sequence
>Lus10002303 pacid=23180876 polypeptide=Lus10002303 locus=Lus10002303.g ID=Lus10002303.BGIv1.0 annot-version=v1.0
MAYFSRRNITAVIAGMMLTVFLVAGKFRRPSATMARSVFDGFVASTCIPNTITDSNLASSITEVNDYLVHNTPSHPEFLLRTHAVTDGVTAYGYAYCYWP
GKSCTSCLNGLVDYVGTNCKNATQADLSSTYCYLKYSPNPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002303 0 1
AT1G29240 Protein of unknown function (D... Lus10029223 4.2 0.7585
AT1G58060 RNA helicase family protein (.... Lus10012695 7.7 0.7090
AT2G32350 Ubiquitin-like superfamily pro... Lus10039679 12.6 0.7580
AT3G18010 HD WOX1 WUSCHEL related homeobox 1 (.1... Lus10018011 22.1 0.7450
AT5G48385 FRIGIDA-like protein (.1) Lus10009979 26.5 0.6268
AT4G18960 MADS AG AGAMOUS, K-box region and MADS... Lus10002763 28.2 0.7087
AT3G44830 Lecithin:cholesterol acyltrans... Lus10019519 29.4 0.7416
AT2G30830 2-oxoglutarate (2OG) and Fe(II... Lus10023600 29.7 0.6790
AT1G19850 ARF IAA24, ARF5, MP MONOPTEROS, indole-3-acetic ac... Lus10024320 43.6 0.6886
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10007208 52.2 0.6676

Lus10002303 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.