Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATMG00980 223 / 9e-77 ATMG00980.1, RPSL2 Ribosomal protein S12/S23 family protein (.1) AT2G07675 223 / 9e-77 Ribosomal protein S12/S23 family protein (.1) ATCG00905 111 / 5e-33 ATCG00905.1, RPS12C ribosomal protein S12C (.1) ATCG01230 111 / 5e-33 ATCG01230.1, RPS12B ribosomal protein S12B (.1) AT2G07773 48 / 2e-07 unknown protein ATMG00910 47 / 4e-07 ATMG00910.1, ORF215A unknown protein ATCG00065 37 / 0.0002 ATCG00065.1, RPS12A ribosomal protein S12A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G208300 [exp] 84 / 4e-22 ATCG00905 139 / 3e-44 ribosomal protein S12C (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF00164 [flax] [poplar] Ribosom_S12_S23 Ribosomal protein S12/S23
Representative CDS sequence Show only first row Show all	>Lus10002330 pacid=23167893 polypeptide=Lus10002330 locus=Lus10002330.g ID=Lus10002330.BGIv1.0 annot-version=v1.0 ATGCCTACATTAAATCAATTGATTCGTCATGGGAGAGAAGAAAAACGGCGCACGGACCGTACTCGAGCTTTGGACCAATGTCCCCAGAAGCAAGGAGTAT GCCCGTGTGTTTCAACGAGAACACCGAAAAAACCGAATTCAGCTCCACGTAACATAGCCAGAGTACAGTTGAGCAATCGACATGATATATTTGCTCACAT TCCAGGCAAAGGACATAATTTGCAGGAACATTCTATGGTCTTGATAAGAGGAGGTAGAGTAAGAGATTCGCCAGGTGTGAAATCCCATTATATTCGAGGA GTGAAGGATTTGCTAGGAATTCCAGATCGAAGAAGAGGCAGATCAAAATATGGTGCGGAGAAACTCAAATCGATATGA
AA sequence Show only first row Show all	>Lus10002330 pacid=23167893 polypeptide=Lus10002330 locus=Lus10002330.g ID=Lus10002330.BGIv1.0 annot-version=v1.0 MPTLNQLIRHGREEKRRTDRTRALDQCPQKQGVCPCVSTRTPKKPNSAPRNIARVQLSNRHDIFAHIPGKGHNLQEHSMVLIRGGRVRDSPGVKSHYIRG VKDLLGIPDRRRGRSKYGAEKLKSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G07675			Ribosomal protein S12/S23 fami...		Lus10002330 [exp]	0	1
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10000459 [exp]	2.8	0.9769
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10009720 [exp]	4.0	0.9760
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10000460 [exp]	4.9	0.9756
ATMG00080		ATMG00080.1, RP...	ribosomal protein L16 (.1)		Lus10004083 [exp]	6.0	0.9746
AT3G12440			Polynucleotidyl transferase, r...		Lus10000103 [exp]	7.9	0.9638
ATCG01280		ATCG01280.1, YC...	Chloroplast Ycf2;ATPase, AAA t...		Lus10002548 [exp]	8.5	0.9491
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10015033 [exp]	8.5	0.9635
AT1G20960		EMB1507	embryo defective 1507, U5 smal...		Lus10025169 [exp]	8.7	0.9659
					Lus10004082 [exp]	9.2	0.9575
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10000087 [exp]	10.1	0.9658

Compare expression of checked genes

Lus10002330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.