Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003173 [exp] 128 / 6e-39 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002336 pacid=23179512 polypeptide=Lus10002336 locus=Lus10002336.g ID=Lus10002336.BGIv1.0 annot-version=v1.0 ATGGTCAAGAAGGAAGATGAAAAGTCTCAGAAGAAGGCTGTGAAGAAGATGAACATCAATGAGTTTCTGAAGCCGGCTAAGAAGGGATACGGACTTCGGA TATTCGATGACCACCGATCAGGTGGTAGGGTGGTGAACGGCAAAGTTAGTGAGGTTGCTGCAGAAGTGCCAGAGGACGGTTCCCTGGACTTGGGCGACTT CCCTGTGCTTGGAGCGGCAAGGCATAAGATTTTGTAG
AA sequence Show only first row Show all	>Lus10002336 pacid=23179512 polypeptide=Lus10002336 locus=Lus10002336.g ID=Lus10002336.BGIv1.0 annot-version=v1.0 MVKKEDEKSQKKAVKKMNINEFLKPAKKGYGLRIFDDHRSGGRVVNGKVSEVAAEVPEDGSLDLGDFPVLGAARHKIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002336 [exp]	0	1
AT4G02780		ATCPS1, ABC33, ...	GA REQUIRING 1, CPP synthase, ...		Lus10022047 [exp]	3.3	0.9868
					Lus10003173 [exp]	4.2	0.9819
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10024120 [exp]	7.3	0.9851
AT4G19880			Glutathione S-transferase fami...		Lus10014304 [exp]	8.9	0.9819
AT3G22370		AtHSR3, ATAOX1A...	hyper-sensitivity-related 3, a...		Lus10035670 [exp]	11.3	0.9787
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10020714 [exp]	11.7	0.9708
AT4G02780		ATCPS1, ABC33, ...	GA REQUIRING 1, CPP synthase, ...		Lus10042593 [exp]	11.8	0.9780
AT5G14040		PHT3;1	phosphate transporter 3;1 (.1)		Lus10036014 [exp]	14.7	0.9773
AT1G14550			Peroxidase superfamily protein...		Lus10024209 [exp]	15.9	0.9741
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10006552 [exp]	16.4	0.9729

Compare expression of checked genes

Lus10002336 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.