Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25220 227 / 1e-77 FKBP15-1 FK506-binding protein 15 kD-1 (.1) AT5G48580 219 / 2e-74 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT5G48570 105 / 4e-27 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G25230 104 / 8e-27 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT5G45680 97 / 1e-25 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT4G39710 82 / 1e-19 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT4G25340 84 / 3e-19 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT3G55520 79 / 9e-19 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 75 / 8e-18 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 71 / 1e-15 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003170 [exp] 302 / 2e-107 AT3G25220 226 / 4e-77 FK506-binding protein 15 kD-1 (.1) Lus10025889 [exp] 214 / 2e-72 AT5G48580 196 / 1e-65 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10038215 [exp] 218 / 6e-70 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10035800 [exp] 140 / 1e-43 AT5G48580 127 / 1e-38 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10003171 [exp] 105 / 6e-27 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 103 / 2e-26 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10038216 [exp] 103 / 2e-26 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10002338 [exp] 103 / 3e-26 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10006949 [exp] 93 / 6e-24 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G248200 [exp] 253 / 1e-87 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.014G149400 [exp] 109 / 1e-28 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248300 [exp] 105 / 7e-27 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.012G129200 [exp] 100 / 2e-25 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.001G075500 [exp] 94 / 3e-24 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.006G033400 [exp] 93 / 1e-22 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 90 / 1e-21 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.008G057900 [exp] 79 / 1e-18 AT3G55520 236 / 7e-80 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G079700 [exp] 76 / 1e-17 AT4G39710 243 / 1e-81 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.010G201600 [exp] 75 / 2e-17 AT3G55520 219 / 2e-73 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00254 [flax] [poplar] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Lus10002339 pacid=23179514 polypeptide=Lus10002339 locus=Lus10002339.g ID=Lus10002339.BGIv1.0 annot-version=v1.0 ATGAATCAGAGCTCTGTATCGAAAGCTGCGGCGATCTTCTTCTTGCTGGCCATGTCTTCATTAGTTTCGGCGAAGAAGTCGAAGGATGTGACAGAGCTAC AGATCGGCGTCAAGTACAAACCCGAATCTTGTGAAATTCAGGCTCATAAGGGAGACAGGATCAAAGTACACTACCGGGGAATGCTAACTGATGGCACAGT TTTCGACTCGAGCTTTGAAAGGGGTGACCCTTTTGAGTTTGAGCTTGGTGGTGGTCAAGTTATCAAAGGATGGGACCAGGGACTGCTGGGAACTTGTGTA GGCGAGAAGCGGAAGTTGAAAATCCCTTCGAAACTCGGTTATGGTGACAGAGGTTCTCCCCCGAAAATCCCAGGTGGAGCAACGTTGATATTCGACACCG AGCTTATAGCAGTGAACGGGAAGACAAACAGTGGAGAGACTGCTGCTGATAGTGAGTTGTAG
AA sequence Show only first row Show all	>Lus10002339 pacid=23179514 polypeptide=Lus10002339 locus=Lus10002339.g ID=Lus10002339.BGIv1.0 annot-version=v1.0 MNQSSVSKAAAIFFLLAMSSLVSAKKSKDVTELQIGVKYKPESCEIQAHKGDRIKVHYRGMLTDGTVFDSSFERGDPFEFELGGGQVIKGWDQGLLGTCV GEKRKLKIPSKLGYGDRGSPPKIPGGATLIFDTELIAVNGKTNSGETAADSEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25220		FKBP15-1	FK506-binding protein 15 kD-1 ...		Lus10002339 [exp]	0	1
AT3G66654			Cyclophilin-like peptidyl-prol...		Lus10016265 [exp]	1.4	0.8671
AT2G21870		MGP1	MALE GAMETOPHYTE DEFECTIVE 1, ...		Lus10005794 [exp]	2.4	0.8686
AT4G08520			SNARE-like superfamily protein...		Lus10006883 [exp]	3.0	0.8654
AT2G28720			Histone superfamily protein (....		Lus10017456 [exp]	3.5	0.8247
AT1G71190		TTN4, SAG18	senescence associated gene 18 ...		Lus10001354 [exp]	8.9	0.8065
AT2G39725			LYR family of Fe/S cluster bio...		Lus10025710 [exp]	9.4	0.7140
AT5G47060			Protein of unknown function (D...		Lus10019494 [exp]	9.6	0.8421
AT1G22450		ATCOX6B2, COX6B	CYTOCHROME C OXIDASE 6B2, cyto...		Lus10010345 [exp]	10.2	0.8144
AT4G08520			SNARE-like superfamily protein...		Lus10037624 [exp]	10.9	0.7889
AT3G03800		ATSYP131, SYP13...	syntaxin of plants 131 (.1)		Lus10010655 [exp]	15.0	0.8279

Compare expression of checked genes

Lus10002339 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.