Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01120 42 / 4e-05 Protein of unknown function (DUF674) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003166 [exp] 211 / 1e-70 AT3G09110 104 / 3e-26 Protein of unknown function (DUF674) (.1) Lus10003167 [exp] 145 / 9e-45 AT3G09140 100 / 5e-25 Protein of unknown function (DUF674) (.1), Protein of unknown function (DUF674) (.2) Lus10003163 [exp] 144 / 3e-44 AT3G09110 100 / 2e-24 Protein of unknown function (DUF674) (.1) Lus10003164 [exp] 132 / 2e-39 AT5G01130 95 / 6e-23 Protein of unknown function (DUF674) (.1) Lus10003168 [exp] 129 / 2e-38 AT5G01150 94 / 2e-22 Protein of unknown function (DUF674) (.1) Lus10011225 [exp] 94 / 2e-24 AT5G01150 89 / 4e-20 Protein of unknown function (DUF674) (.1) Lus10040317 [exp] 59 / 3e-12 AT5G01140 39 / 1e-04 Protein of unknown function (DUF674) (.1) Lus10008717 [exp] 45 / 7e-07 AT2G40070 52 / 5e-09 unknown protein Lus10038209 [exp] 45 / 2e-06 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G210800 [exp] 87 / 5e-22 AT3G09110 86 / 2e-19 Protein of unknown function (DUF674) (.1) Potri.010G210500 [exp] 85 / 3e-21 AT3G09110 73 / 4e-15 Protein of unknown function (DUF674) (.1) Potri.010G210400 [exp] 84 / 3e-21 ND / Potri.008G050100 [exp] 84 / 5e-21 ND / Potri.008G050000 [exp] 74 / 5e-17 AT3G09110 94 / 1e-22 Protein of unknown function (DUF674) (.1) Potri.001G247200 [exp] 57 / 1e-10 AT5G01120 189 / 8e-54 Protein of unknown function (DUF674) (.1) Potri.001G247300 [exp] 54 / 2e-09 AT5G43240 176 / 5e-49 Protein of unknown function (DUF674) (.1), Protein of unknown function (DUF674) (.2), Protein of unknown function (DUF674) (.3) Potri.010G210600 [exp] 52 / 3e-09 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05056 [flax] [poplar] DUF674 Protein of unknown function (DUF674)
Representative CDS sequence Show only first row Show all	>Lus10002340 pacid=23179505 polypeptide=Lus10002340 locus=Lus10002340.g ID=Lus10002340.BGIv1.0 annot-version=v1.0 ATGTGCCCAAATAACCACAGGAATGCTGCTGATAACCCACGAGCAATTTGTCCTAGATGCAACCGTTCTATGAGGTACGAAGCTTCCTTCATAGCCAGCA AGTATGAAGCTGAGATTGGGAATAACCAGGAGAATGAAGGTGGTGGGTTTGTGAAGGGAGTTGTGACGTATATGGTGGTGGACAACTTGGAGGTGAGGCC AATGTCTAACATCTCCAGCATTGCTATGCTCAAGGAGTTCAACATTCAGCATGTTGGTGCCCTTGAGGAGAAAGTCGTAGAGGTTGGGATGGATGAGGGG CTGAAGCTGCTCAAGGCTTCTATGCAGTCCAGGACTGTTCTCACCAATGTCTTACTCCGAGGATGGCTTGGTTGA
AA sequence Show only first row Show all	>Lus10002340 pacid=23179505 polypeptide=Lus10002340 locus=Lus10002340.g ID=Lus10002340.BGIv1.0 annot-version=v1.0 MCPNNHRNAADNPRAICPRCNRSMRYEASFIASKYEAEIGNNQENEGGGFVKGVVTYMVVDNLEVRPMSNISSIAMLKEFNIQHVGALEEKVVEVGMDEG LKLLKASMQSRTVLTNVLLRGWLG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01150			Protein of unknown function (D...		Lus10002340 [exp]	0	1
AT4G00980			zinc knuckle (CCHC-type) famil...		Lus10020454 [exp]	4.4	0.7940
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10008682 [exp]	9.7	0.7347
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	12.7	0.7270
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	14.7	0.7270
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10007909 [exp]	16.3	0.7199
AT5G37060		ATCHX24	cation/H+ exchanger 24, ARABID...		Lus10031852 [exp]	18.0	0.7148
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10011999 [exp]	20.1	0.7119
					Lus10015636 [exp]	20.5	0.6883
					Lus10011637 [exp]	21.9	0.7069
AT4G35150			O-methyltransferase family pro...		Lus10012408 [exp]	22.0	0.6903

Compare expression of checked genes

Lus10002340 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.