Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011225 [exp] 45 / 2e-06 AT5G01150 89 / 4e-20 Protein of unknown function (DUF674) (.1) Lus10003164 [exp] 0 / 1 AT5G01130 95 / 6e-23 Protein of unknown function (DUF674) (.1) Lus10003167 [exp] 0 / 1 AT3G09140 100 / 5e-25 Protein of unknown function (DUF674) (.1), Protein of unknown function (DUF674) (.2) Lus10003163 [exp] 0 / 1 AT3G09110 100 / 2e-24 Protein of unknown function (DUF674) (.1) Lus10003168 [exp] 0 / 1 AT5G01150 94 / 2e-22 Protein of unknown function (DUF674) (.1) Lus10003166 [exp] 0 / 1 AT3G09110 104 / 3e-26 Protein of unknown function (DUF674) (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002348 pacid=23179495 polypeptide=Lus10002348 locus=Lus10002348.g ID=Lus10002348.BGIv1.0 annot-version=v1.0 ATGCACCCTATCCAACTATCTCATTTTGACTACAATGGCGACCACCACAACCTCCAAAGTGGCACTGAAGCTCCTGGTCGACAAGAAGACCAACAGAGTC CTGTTTGCCGAAGCAGGAAAGGAGTTCGTCGATTTCCTCTTCAATCTGCTCTCCTTTCCACTCGGAACGGTGATCAAACTCCTGTCCAAGAACAAAATGG CGGGCTGCCTCTGAAATTTGTACCAGAGATCGAGGAATTGAGCGACACGCTCATCCAGCCGAATCGGAGCAAGGACACTGTTCTGAACCCGAGGTCTCCG TTCCAATTTGACGGTGAACCCGAGGTCTCCGCTCCAATTGAACGGTGA
AA sequence Show only first row Show all	>Lus10002348 pacid=23179495 polypeptide=Lus10002348 locus=Lus10002348.g ID=Lus10002348.BGIv1.0 annot-version=v1.0 MHPIQLSHFDYNGDHHNLQSGTEAPGRQEDQQSPVCRSRKGVRRFPLQSALLSTRNGDQTPVQEQNGGLPLKFVPEIEELSDTLIQPNRSKDTVLNPRSP FQFDGEPEVSAPIER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002348 [exp]	0	1
AT1G70620			cyclin-related (.1.2.3)		Lus10026699 [exp]	7.2	0.8134
AT5G49350			Glycine-rich protein family (....		Lus10037727 [exp]	8.4	0.7480
AT2G39210			Major facilitator superfamily ...		Lus10021513 [exp]	11.0	0.7943
AT1G05675			UDP-Glycosyltransferase superf...		Lus10039041 [exp]	12.7	0.7721
AT5G67140			F-box/RNI-like superfamily pro...		Lus10024178 [exp]	27.7	0.7481
AT1G23540		IGI1, AtPERK12	proline-rich extensin-like rec...		Lus10030610 [exp]	28.0	0.7471
					Lus10000768 [exp]	31.9	0.7427
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10042994 [exp]	38.9	0.7615
AT5G49360		ATBXL1, BXL1	beta-xylosidase 1 (.1)		Lus10037728 [exp]	44.2	0.7053
AT1G16650			S-adenosyl-L-methionine-depend...		Lus10005589 [exp]	54.0	0.7383

Compare expression of checked genes

Lus10002348 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.