Lus10002358 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48030 144 / 1e-43 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042137 174 / 4e-52 AT3G48050 764 / 0.0 'shuttle' in chinese, BAH domain ;TFIIS helical bundle-like domain (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G073300 144 / 1e-46 AT3G48030 156 / 4e-48 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
Potri.012G078000 143 / 2e-46 AT3G48030 156 / 2e-48 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04588 HIG_1_N Hypoxia induced protein conserved region
Representative CDS sequence
>Lus10002358 pacid=23179432 polypeptide=Lus10002358 locus=Lus10002358.g ID=Lus10002358.BGIv1.0 annot-version=v1.0
ATGGTTGCCGTGGAGCCTAACCTGGACCAGTTCTACGAGGAGAAGAAGCGCGTTAGAAACCCTTTCGTCCCCATAGGTGCACTGATGACGGCTGGAGTGC
TGACGGCGGGACTAGTAAGCTTCAGAAGAGGGAATTCGCAGCTGGGGCAGAAGTTGATGAGAGCTAGAGTGGTTGTACAAGGAGCAACTGTGGCTCTTAT
GGTTGGGACTGCATTCTACTATGAACAGAACCCCTGGAAAAAGTCTGACTGA
AA sequence
>Lus10002358 pacid=23179432 polypeptide=Lus10002358 locus=Lus10002358.g ID=Lus10002358.BGIv1.0 annot-version=v1.0
MVAVEPNLDQFYEEKKRVRNPFVPIGALMTAGVLTAGLVSFRRGNSQLGQKLMRARVVVQGATVALMVGTAFYYEQNPWKKSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48030 hypoxia-responsive family prot... Lus10002358 0 1
AT3G10860 Cytochrome b-c1 complex, subun... Lus10019118 1.4 0.8671
AT3G21220 ATMAP2K_ALPHA, ... ARABIDOPSIS THALIANA MITOGEN-A... Lus10037340 2.0 0.8520
AT2G20860 LIP1 lipoic acid synthase 1 (.1) Lus10031630 3.5 0.8474
AT5G62810 ATPEX14, PED2, ... PEROXISOME DEFECTIVE 2, peroxi... Lus10002378 7.7 0.8333
AT5G51040 unknown protein Lus10043024 9.8 0.8272
AT4G22240 Plastid-lipid associated prote... Lus10001099 10.6 0.8321
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10032157 13.3 0.8425
AT5G61640 PMSR1, ATMSRA1 ARABIDOPSIS THALIANA METHIONIN... Lus10033039 13.3 0.8167
Lus10002306 15.9 0.7702
AT1G14340 RNA-binding (RRM/RBD/RNP motif... Lus10012843 16.5 0.8100

Lus10002358 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.