Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70690 38 / 0.001 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042124 [exp] 205 / 2e-67 AT3G58310 46 / 1e-05 Domain of unknown function (DUF26) (.1) Lus10007506 [exp] 62 / 4e-13 AT3G22040 39 / 5e-04 Domain of unknown function (DUF26) (.1) Lus10007505 [exp] 59 / 2e-11 ND 39 / 0.002 Lus10011040 [exp] 55 / 2e-10 AT3G21940 38 / 8e-04 Receptor protein kinase-related (.1) Lus10007508 [exp] 53 / 4e-10 ND / Lus10028981 [exp] 53 / 1e-09 ND 35 / 0.007 Lus10007507 [exp] 52 / 4e-09 ND / Lus10028982 [exp] 50 / 2e-08 ND / Lus10019333 [exp] 39 / 0.0003 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G024140 [exp] 43 / 1e-05 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G026350 [exp] 42 / 5e-05 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.004G023876 [exp] 41 / 6e-05 AT4G23180 489 / 5e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024900 [exp] 41 / 7e-05 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.011G030200 [exp] 41 / 8e-05 AT4G23220 558 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 14 (.1) Potri.004G025900 [exp] 41 / 8e-05 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) Potri.004G025001 [exp] 41 / 9e-05 AT4G05200 465 / 4e-158 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G026000 [exp] 40 / 0.0001 AT4G05200 353 / 3e-116 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G023700 [exp] 39 / 0.0003 AT4G05200 474 / 3e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G024000 [exp] 39 / 0.0003 AT4G23180 489 / 4e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [flax] [poplar] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Lus10002371 pacid=23179412 polypeptide=Lus10002371 locus=Lus10002371.g ID=Lus10002371.BGIv1.0 annot-version=v1.0 ATGACCAAGGGAGTTGTCGGGGACGAATATTTCAATTGCCGTCGGACTACCACTTCATTCGACCCATCTCACTCCCGAGAGCTAAAATATTGCACAGACA CCCTGACTAGCCAACTTGACTCCGGTTATTTCGTGACGTGGCCAACTGATCGGGACAAGTTAATGTATTGTCCTCAAGAGGGTGGAAAATACCCAGATAT GTTCATCTGGGTCACTTGTAGCTCTGCACCCACTGCTACTCCAGAAGATTGCCAACAGTGTCTTGCGAGTGCTGCGTCGATGATGAACCAGTGTTGTTCA AACTCGTACGGTGTGTATCTTAACAGCGCCCATTGTACGGTTAGGTACGAGACCTACAACTTCACCAGCTGA
AA sequence Show only first row Show all	>Lus10002371 pacid=23179412 polypeptide=Lus10002371 locus=Lus10002371.g ID=Lus10002371.BGIv1.0 annot-version=v1.0 MTKGVVGDEYFNCRRTTTSFDPSHSRELKYCTDTLTSQLDSGYFVTWPTDRDKLMYCPQEGGKYPDMFIWVTCSSAPTATPEDCQQCLASAASMMNQCCS NSYGVYLNSAHCTVRYETYNFTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38830		CRK26	cysteine-rich RLK (RECEPTOR-li...		Lus10002371 [exp]	0	1
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10040326 [exp]	6.9	0.9203
					Lus10019504 [exp]	7.1	0.8482
					Lus10013654 [exp]	9.2	0.9122
AT4G18210		ATPUP10	purine permease 10 (.1)		Lus10026130 [exp]	9.5	0.8681
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002933 [exp]	12.5	0.9105
AT3G02750			Protein phosphatase 2C family ...		Lus10022683 [exp]	16.5	0.8973
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	17.2	0.9076
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	19.2	0.9067
AT1G49490			Leucine-rich repeat (LRR) fami...		Lus10027935 [exp]	21.0	0.9060
					Lus10015828 [exp]	21.1	0.9065

Compare expression of checked genes

Lus10002371 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.