Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62400 106 / 6e-28 HT1 high leaf temperature 1, Protein kinase superfamily protein (.1) AT5G58950 81 / 2e-18 Protein kinase superfamily protein (.1) AT4G31170 65 / 5e-13 Protein kinase superfamily protein (.1.2.3.4) AT3G46930 62 / 7e-12 Protein kinase superfamily protein (.1) AT5G40540 58 / 2e-10 Protein kinase superfamily protein (.1) AT3G27560 56 / 1e-09 ATN1 Protein kinase superfamily protein (.1) AT2G24360 55 / 2e-09 Protein kinase superfamily protein (.1) AT2G17700 52 / 4e-08 STY8 serine/threonine/tyrosine kinase 8, ACT-like protein tyrosine kinase family protein (.1) AT4G38470 51 / 5e-08 STY46 serine/threonine/tyrosine kinase 46, ACT-like protein tyrosine kinase family protein (.1) AT3G01490 50 / 1e-07 Protein kinase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042122 [exp] 272 / 6e-92 AT1G62400 404 / 7e-141 high leaf temperature 1, Protein kinase superfamily protein (.1) Lus10020018 [exp] 110 / 4e-29 AT1G62400 620 / 0.0 high leaf temperature 1, Protein kinase superfamily protein (.1) Lus10015541 [exp] 112 / 5e-29 AT1G62400 623 / 0.0 high leaf temperature 1, Protein kinase superfamily protein (.1) Lus10011173 [exp] 80 / 6e-18 AT5G58950 567 / 0.0 Protein kinase superfamily protein (.1) Lus10015436 [exp] 79 / 1e-17 AT5G58950 572 / 0.0 Protein kinase superfamily protein (.1) Lus10025442 [exp] 78 / 4e-17 AT5G58950 510 / 2e-178 Protein kinase superfamily protein (.1) Lus10015314 [exp] 77 / 6e-17 AT5G58950 318 / 1e-105 Protein kinase superfamily protein (.1) Lus10009550 [exp] 65 / 1e-12 AT5G16730 571 / 0.0 Plant protein of unknown function (DUF827) (.1) Lus10020374 [exp] 63 / 6e-12 AT4G31170 697 / 0.0 Protein kinase superfamily protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G075200 [exp] 182 / 4e-57 AT1G62400 404 / 2e-141 high leaf temperature 1, Protein kinase superfamily protein (.1) Potri.012G080000 [exp] 176 / 8e-55 AT1G62400 405 / 9e-142 high leaf temperature 1, Protein kinase superfamily protein (.1) Potri.004G001900 [exp] 110 / 3e-29 AT1G62400 620 / 0.0 high leaf temperature 1, Protein kinase superfamily protein (.1) Potri.011G022800 [exp] 106 / 1e-27 AT1G62400 613 / 0.0 high leaf temperature 1, Protein kinase superfamily protein (.1) Potri.005G082200 [exp] 92 / 4e-22 AT5G58950 607 / 0.0 Protein kinase superfamily protein (.1) Potri.007G085300 [exp] 87 / 1e-20 AT5G58950 604 / 0.0 Protein kinase superfamily protein (.1) Potri.006G280000 [exp] 69 / 3e-14 AT4G31170 677 / 0.0 Protein kinase superfamily protein (.1.2.3.4) Potri.018G001800 [exp] 69 / 4e-14 AT2G24360 663 / 0.0 Protein kinase superfamily protein (.1) Potri.006G279900 [exp] 65 / 8e-13 AT2G24360 642 / 0.0 Protein kinase superfamily protein (.1) Potri.018G001900 [exp] 65 / 1e-12 AT2G24360 648 / 0.0 Protein kinase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10002373 pacid=23179407 polypeptide=Lus10002373 locus=Lus10002373.g ID=Lus10002373.BGIv1.0 annot-version=v1.0 ATGAGGAAACTACACTGGTTCAAGCACCAATCCAATTACAACCAGGAGAAGAAATCATCAGAGGCGGCAGGGAGGACACTTTCACTAGGGGAGTACAGGA GGGCAATCTCATGGTCCAAGTATCTAGTCTCATCTGGTGCTGAAATCAAACTCAAAGGGGAAGGAGATCAGGAATGGAGTGCTGATATGTCACAGTTGTT TATAGGCAACAAGTTTGCATCAGGTAAGCACAGCAGGATCTACAGAGGGATTTACAAGCAAAGGGATGTGGCAATCAAGCTCATCAGCCAGCCTCAGGAG GATGAAGATTTGGCTTCTTTTCTTGAGAAACAGTTCTCTTCTGAAGTTGCTTTGCTCTTCCAGTTGTGCCATCATCCCAATATCATCACTGTAAGTATCC CTTCTTCCTCCTTTCATTGTTGGGTTTTACAGTTTTTTGTTGGTTGTAAGACTTGTGAGAATATGTGGTCCAATTCTGGTACAATTTGGTAA
AA sequence Show only first row Show all	>Lus10002373 pacid=23179407 polypeptide=Lus10002373 locus=Lus10002373.g ID=Lus10002373.BGIv1.0 annot-version=v1.0 MRKLHWFKHQSNYNQEKKSSEAAGRTLSLGEYRRAISWSKYLVSSGAEIKLKGEGDQEWSADMSQLFIGNKFASGKHSRIYRGIYKQRDVAIKLISQPQE DEDLASFLEKQFSSEVALLFQLCHHPNIITVSIPSSSFHCWVLQFFVGCKTCENMWSNSGTIW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62400		HT1	high leaf temperature 1, Prote...		Lus10002373 [exp]	0	1
AT3G57650		LPAT2	lysophosphatidyl acyltransfera...		Lus10026312 [exp]	3.0	0.8203
AT3G09740		ATSYP71, SYP71	syntaxin of plants 71 (.1)		Lus10036377 [exp]	9.0	0.7986
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10014731 [exp]	10.1	0.8174
AT1G62400		HT1	high leaf temperature 1, Prote...		Lus10002374 [exp]	11.0	0.7979
AT1G34430		EMB3003	embryo defective 3003, 2-oxoac...		Lus10009432 [exp]	17.9	0.8142
AT1G53700		PK3AT, WAG1	PROTEIN KINASE 3 ARABIDOPSIS T...		Lus10005583 [exp]	17.9	0.7935
AT5G52060		ATBAG1	BCL-2-associated athanogene 1 ...		Lus10005772 [exp]	28.4	0.7618
AT4G23820			Pectin lyase-like superfamily ...		Lus10003890 [exp]	39.2	0.8042
AT4G32890	GATA	GATA9	GATA transcription factor 9 (....		Lus10038273 [exp]	43.5	0.7970
AT2G36310		NSH1, URH1	nucleoside hydrolase 1, uridin...		Lus10003251 [exp]	46.0	0.7848

Compare expression of checked genes

Lus10002373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.