Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027891 [exp] 115 / 1e-31 AT5G67360 531 / 3e-178 Subtilase family protein (.1) Lus10002392 [exp] 113 / 8e-31 AT5G67360 530 / 3e-178 Subtilase family protein (.1) Lus10000380 [exp] 85 / 3e-23 ND / Lus10002393 [exp] 92 / 5e-23 AT5G67360 450 / 9e-148 Subtilase family protein (.1) Lus10027893 [exp] 73 / 1e-18 ND 34 / 0.005 Lus10004685 [exp] 37 / 0.0009 AT4G00230 647 / 0.0 xylem serine peptidase 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G100500 [exp] 78 / 3e-18 AT4G34980 541 / 0.0 subtilisin-like serine protease 2 (.1) Potri.014G026500 [exp] 40 / 5e-05 AT5G67090 604 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.001G450600 [exp] 37 / 0.0008 AT1G32960 772 / 0.0 Subtilase family protein (.1) Potri.014G026700 [exp] 37 / 0.0008 AT5G67090 582 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002396 pacid=23170826 polypeptide=Lus10002396 locus=Lus10002396.g ID=Lus10002396.BGIv1.0 annot-version=v1.0 ATGTCGTGGAAGGCGGCTCAGTTTTACCATGCTGTGGTGGAGATCTCTAGTGGCATGACGGCTGTTGTGGAGCCTTCTGTGATCAGTTTTGGAAGGCAAT ATAGTACGGCTGCGTTTAACTTGACTGTGGATGTCGTTTTGGACGGTGGGGTTGGTGGAGGTCAGACTGATTACATTGGGAATTATGGGTTCTTGAGTTG GGGTGAATTGAATGGGACGCATGTTGTTAGGAGTCCAATTGTGTTTGTAATGATACCTCTTAAGACTTGA
AA sequence Show only first row Show all	>Lus10002396 pacid=23170826 polypeptide=Lus10002396 locus=Lus10002396.g ID=Lus10002396.BGIv1.0 annot-version=v1.0 MSWKAAQFYHAVVEISSGMTAVVEPSVISFGRQYSTAAFNLTVDVVLDGGVGGGQTDYIGNYGFLSWGELNGTHVVRSPIVFVMIPLKT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002396 [exp]	0	1
AT2G39210			Major facilitator superfamily ...		Lus10037949 [exp]	2.4	0.7379
AT4G34980		SLP2	subtilisin-like serine proteas...		Lus10002397 [exp]	4.0	0.8225
AT2G45750			S-adenosyl-L-methionine-depend...		Lus10027432 [exp]	5.5	0.7089
AT1G80450			VQ motif-containing protein (....		Lus10026897 [exp]	7.1	0.6692
AT5G26340		ATSTP13, MSS1, ...	SUGAR TRANSPORT PROTEIN 13, Ma...		Lus10021924 [exp]	10.8	0.7499
AT5G61890	AP2_ERF		Integrase-type DNA-binding sup...		Lus10006796 [exp]	15.3	0.6684
AT5G13490		AAC2	ADP/ATP carrier 2 (.1.2)		Lus10031843 [exp]	17.5	0.7262
AT1G68040			S-adenosyl-L-methionine-depend...		Lus10007950 [exp]	17.7	0.7144
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10024366 [exp]	23.7	0.7262
AT2G07180			Protein kinase superfamily pro...		Lus10008546 [exp]	24.0	0.5843

Compare expression of checked genes

Lus10002396 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.