Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34980 71 / 1e-15 SLP2 subtilisin-like serine protease 2 (.1) AT5G67360 68 / 3e-14 ARA12 Subtilase family protein (.1) AT5G51750 63 / 1e-12 ATSBT1.3 subtilase 1.3 (.1) AT3G14067 62 / 2e-12 Subtilase family protein (.1) AT1G01900 62 / 2e-12 SBTI1.1, ATSBT1.1 subtilase family protein (.1) AT2G05920 61 / 5e-12 Subtilase family protein (.1) AT3G14240 57 / 1e-10 Subtilase family protein (.1) AT4G21640 56 / 3e-10 Subtilase family protein (.1) AT5G67090 56 / 3e-10 Subtilisin-like serine endopeptidase family protein (.1) AT4G10520 55 / 1e-09 Subtilase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002392 [exp] 222 / 1e-69 AT5G67360 530 / 3e-178 Subtilase family protein (.1) Lus10027891 [exp] 215 / 5e-67 AT5G67360 531 / 3e-178 Subtilase family protein (.1) Lus10000379 [exp] 164 / 9e-51 AT5G67360 171 / 2e-47 Subtilase family protein (.1) Lus10002393 [exp] 149 / 6e-43 AT5G67360 450 / 9e-148 Subtilase family protein (.1) Lus10027895 [exp] 139 / 3e-40 AT2G04160 207 / 5e-59 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10034496 [exp] 74 / 2e-16 AT4G34980 670 / 0.0 subtilisin-like serine protease 2 (.1) Lus10013187 [exp] 68 / 3e-14 AT3G14240 1175 / 0.0 Subtilase family protein (.1) Lus10037449 [exp] 67 / 7e-14 AT3G14240 1177 / 0.0 Subtilase family protein (.1) Lus10008921 [exp] 67 / 8e-14 AT5G67360 377 / 7e-122 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G100500 [exp] 138 / 5e-39 AT4G34980 541 / 0.0 subtilisin-like serine protease 2 (.1) Potri.014G026600 [exp] 76 / 5e-17 AT5G67360 546 / 0.0 Subtilase family protein (.1) Potri.004G173900 [exp] 71 / 3e-15 AT4G34980 1108 / 0.0 subtilisin-like serine protease 2 (.1) Potri.002G124500 [exp] 70 / 5e-15 AT5G67090 577 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.009G133400 [exp] 69 / 7e-15 AT4G34980 1121 / 0.0 subtilisin-like serine protease 2 (.1) Potri.004G161400 [exp] 69 / 8e-15 AT4G10550 659 / 0.0 Subtilase family protein (.1.2.3) Potri.012G131500 [exp] 69 / 1e-14 AT5G51750 1102 / 0.0 subtilase 1.3 (.1) Potri.014G026700 [exp] 67 / 6e-14 AT5G67090 582 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.006G141200 [exp] 66 / 2e-13 AT2G05920 1103 / 0.0 Subtilase family protein (.1) Potri.015G133800 [exp] 65 / 3e-13 AT5G51750 1113 / 0.0 subtilase 1.3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002397 pacid=23170818 polypeptide=Lus10002397 locus=Lus10002397.g ID=Lus10002397.BGIv1.0 annot-version=v1.0 ATGGATGAGGCCGATGTAGAGTTCTACGGCCACGCTACGGATCTTGACACGCCGTATGTCATGGTGAGCACGAAAATTGGAGACACGATCAAGGGATACA TACTCAACTCAACTAACTCGACCGTGGGTGTGAACTTCCGCGTGACAATTTATGGGCACAAATCGGCTCCTAAGGTCACATACATCAGTTCAAGAGGAAC TGATGAAAGATCTTCTTGGATATTGAAGCCGGACCTTATTGCCCCCGGCTACGACATCCTAGCCGTGTGGGCCCCGAATCGGGCTTTTGCCCCTATTCGA GGAGGGGATGATTACTTGCAGACGGATTATGCTATCATCTCAGGTACACAATAA
AA sequence Show only first row Show all	>Lus10002397 pacid=23170818 polypeptide=Lus10002397 locus=Lus10002397.g ID=Lus10002397.BGIv1.0 annot-version=v1.0 MDEADVEFYGHATDLDTPYVMVSTKIGDTIKGYILNSTNSTVGVNFRVTIYGHKSAPKVTYISSRGTDERSSWILKPDLIAPGYDILAVWAPNRAFAPIR GGDDYLQTDYAIISGTQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34980		SLP2	subtilisin-like serine proteas...		Lus10002397 [exp]	0	1
AT5G13490		AAC2	ADP/ATP carrier 2 (.1.2)		Lus10031843 [exp]	3.7	0.8894
					Lus10002396 [exp]	4.0	0.8225
AT1G24140			Matrixin family protein (.1)		Lus10005605 [exp]	6.3	0.8844
AT1G69630			F-box/RNI-like superfamily pro...		Lus10023042 [exp]	7.5	0.8598
AT1G24140			Matrixin family protein (.1)		Lus10039464 [exp]	8.5	0.8798
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10024366 [exp]	10.2	0.8791
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10015286 [exp]	10.2	0.8779
AT5G20230		SAG14, ATBCB	SENESCENCE ASSOCIATED GENE 14,...		Lus10025752 [exp]	12.0	0.7737
AT3G57260		AtPR2, PR-2, PR...	PATHOGENESIS-RELATED PROTEIN 2...		Lus10027860 [exp]	13.4	0.8652
AT3G47570			Leucine-rich repeat protein ki...		Lus10030845 [exp]	14.7	0.8546

Compare expression of checked genes

Lus10002397 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.