Lus10002415 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10002415 pacid=23145810 polypeptide=Lus10002415 locus=Lus10002415.g ID=Lus10002415.BGIv1.0 annot-version=v1.0
ATGACGGAAGGTCACTTGACTTATCCCAAAATTGCGAGGAGGTCACAGGACTTCCTGGAAAGACGTTCCAGTCATCCTTCTCCTCAGGCGAGACTCGCCG
TCGCTGGCGAGGATTTCCAAAATCCGGGGAGGTCCCGACGAGCTCCAAATTTGCTGGAAACGTGGATTCCGCTGTCGACGAGTTTGCCCACCTTCCGACG
AGTTCTTCCCCCTCCTTGGAAAGTGATTTTCGACCATCACGAGCCCACTCTTCTCGCCGGAGCACTAGGGACCTTCACCGTCCCCGAGCTCTTATTCTCC
GCCGAAGGTGCTGTCGACTCCTCTCTCTCGTGTCGTAGACGCCGCCATCTCTCTCTTGCAAAGCCAATAGTCACTGAAGAAACGACCACCACCGATCCGG
CGCTCTCTATCTAA
AA sequence
>Lus10002415 pacid=23145810 polypeptide=Lus10002415 locus=Lus10002415.g ID=Lus10002415.BGIv1.0 annot-version=v1.0
MTEGHLTYPKIARRSQDFLERRSSHPSPQARLAVAGEDFQNPGRSRRAPNLLETWIPLSTSLPTFRRVLPPPWKVIFDHHEPTLLAGALGTFTVPELLFS
AEGAVDSSLSCRRRRHLSLAKPIVTEETTTTDPALSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002415 0 1
Lus10016269 13.1 0.7215
Lus10006458 15.8 0.6724
AT3G10490 NAC ANAC051, ANAC05... Arabidopsis NAC domain contain... Lus10038670 23.3 0.7025
AT3G04670 WRKY ATWRKY39, WRKY3... WRKY DNA-binding protein 39 (.... Lus10033857 37.5 0.6582
Lus10008346 48.2 0.5465
Lus10012012 53.4 0.6340
AT3G04690 ANX1 ANXUR1, Malectin/receptor-like... Lus10021998 57.2 0.5965
Lus10009774 60.9 0.6322
AT3G01490 Protein kinase superfamily pro... Lus10030868 65.6 0.5358
AT5G25530 DNAJ heat shock family protein... Lus10041254 66.2 0.5600

Lus10002415 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.