Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08580 49 / 4e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040441 [exp] 69 / 6e-17 AT1G08580 110 / 4e-32 unknown protein Lus10023557 [exp] 61 / 5e-13 AT4G39230 461 / 2e-162 NmrA-like negative transcriptional regulator family protein (.1) Lus10000388 [exp] 54 / 7e-12 AT1G08580 61 / 6e-14 unknown protein Lus10003502 [exp] 55 / 2e-11 AT1G08580 81 / 9e-21 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G049300 [exp] 53 / 8e-11 AT1G08580 80 / 3e-20 unknown protein Potri.013G091200 [exp] 44 / 1e-07 AT1G08580 66 / 2e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002417 pacid=23142755 polypeptide=Lus10002417 locus=Lus10002417.g ID=Lus10002417.BGIv1.0 annot-version=v1.0 ATGGCGAAGTTCAATGAAGTGCTCAACTGGAAGAGAGCAGCGATAGCTGAAAAAAAAAAGAGAATCGCTCACGGTGATCCACTTACCGCTAAATTGAAGG CTAAACTACAAAATCAATCTGTCTCTGGTAAACGAAAGCGCAAGATGTTGACAATATGGCGCAGAGACTAG
AA sequence Show only first row Show all	>Lus10002417 pacid=23142755 polypeptide=Lus10002417 locus=Lus10002417.g ID=Lus10002417.BGIv1.0 annot-version=v1.0 MAKFNEVLNWKRAAIAEKKKRIAHGDPLTAKLKAKLQNQSVSGKRKRKMLTIWRRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08580			unknown protein		Lus10002417 [exp]	0	1

Compare expression of checked genes

Lus10002417 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.