Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G106550 [exp] 53 / 3e-11 ND / Potri.002G073450 [exp] 43 / 1e-06 ND / Potri.007G062061 [exp] 0 / 1 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002418 pacid=23142754 polypeptide=Lus10002418 locus=Lus10002418.g ID=Lus10002418.BGIv1.0 annot-version=v1.0 ATGGATAACGCTTGCATCCTCTGTATTACCGCAGTTGCTGGCACAGAGTTAGCTGATGCTTATTCCCCAGATACCGTCATTGCTTCTTCTCCAGGAAAAG AAGTTCATGACCCGCAGGCCTTCTACCTCCACGAGTCATTGCTCCGTCCAGCTTTCGCCTATTGCGGAAAATTCCTCACTACTGCCTCCCATAGGAGTCT TGGCCGTATCTCAGTCCTAGTGTGGCTTCGGACCAGCTACTAA
AA sequence Show only first row Show all	>Lus10002418 pacid=23142754 polypeptide=Lus10002418 locus=Lus10002418.g ID=Lus10002418.BGIv1.0 annot-version=v1.0 MDNACILCITAVAGTELADAYSPDTVIASSPGKEVHDPQAFYLHESLLRPAFAYCGKFLTTASHRSLGRISVLVWLRTSY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002418 [exp]	0	1
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002933 [exp]	3.6	0.9627
					Lus10015828 [exp]	6.9	0.9529
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	9.2	0.9497
					Lus10043307 [exp]	9.2	0.9439
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	10.4	0.9493
AT2G03200			Eukaryotic aspartyl protease f...		Lus10022917 [exp]	11.2	0.9448
					Lus10040066 [exp]	13.3	0.9171
AT1G16010		AtMRS2-1, AtMGT...	magnesium transporter 2 (.1.2....		Lus10014353 [exp]	14.9	0.7719
AT3G46140			Protein kinase superfamily pro...		Lus10029018 [exp]	15.3	0.9219
AT3G02750			Protein phosphatase 2C family ...		Lus10022683 [exp]	16.5	0.9257

Compare expression of checked genes

Lus10002418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.