Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47270 62 / 4e-14 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) AT3G58850 40 / 2e-05 HLH2, PAR2 phy rapidly regulated 2 (.1) AT2G42870 39 / 7e-05 PAR1 ,HLH1 HELIX-LOOP-HELIX 1, phy rapidly regulated 1 (.1) AT4G30410 37 / 0.0004 sequence-specific DNA binding transcription factors (.1.2) AT4G30180 37 / 0.0005 bHLH bHLH146 sequence-specific DNA binding transcription factors;transcription regulators (.1) AT1G23965 36 / 0.001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001447 [exp] 119 / 1e-36 AT2G47270 69 / 2e-16 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10010001 [exp] 52 / 4e-10 AT2G47270 52 / 6e-10 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Lus10038432 [exp] 38 / 0.0003 AT1G30670 108 / 4e-28 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Lus10030844 [exp] 36 / 0.0009 AT1G23965 48 / 2e-08 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G118300 [exp] 74 / 2e-18 AT2G47270 62 / 2e-13 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.002G193300 [exp] 74 / 3e-18 AT2G47270 79 / 5e-20 UPBEAT1, sequence-specific DNA binding transcription factors;transcription regulators (.1) Potri.002G060100 [exp] 47 / 1e-07 AT3G58850 80 / 4e-20 phy rapidly regulated 2 (.1) Potri.005G201500 [exp] 45 / 5e-07 AT3G58850 82 / 4e-21 phy rapidly regulated 2 (.1) Potri.017G093000 [exp] 39 / 7e-05 AT5G39240 64 / 3e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002419 pacid=23179447 polypeptide=Lus10002419 locus=Lus10002419.g ID=Lus10002419.BGIv1.0 annot-version=v1.0 ATGGGCGCTACAGTAATGATCAATAAGAAGACGAGGAGCTGCCGCCGGAGGATGAGAAGAAGGCCTCCGATGGCCGGAATTAGTCGAAGAGTTAGAGCGT TGAAGAAGCTAATACCAAACGGCGAGTCGATGGGCACAGTGGAGGGGCTTTTTAGGGAGACTGCCGATTATATTTTGGGGTTGGAGATGAGGGTTTCACT CATGCAGATTATGCTTCAAGATCTGACGGCTGCTGCTGCTACTACTACTACTTGTGATTCTTTTCACCATCAGTTCCGAATGTAA
AA sequence Show only first row Show all	>Lus10002419 pacid=23179447 polypeptide=Lus10002419 locus=Lus10002419.g ID=Lus10002419.BGIv1.0 annot-version=v1.0 MGATVMINKKTRSCRRRMRRRPPMAGISRRVRALKKLIPNGESMGTVEGLFRETADYILGLEMRVSLMQIMLQDLTAAAATTTTCDSFHHQFRM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47270	bHLH	bHLH151, UPB1	UPBEAT1, sequence-specific DNA...		Lus10002419 [exp]	0	1
AT4G20140		GSO1	GASSHO1, Leucine-rich repeat t...		Lus10027688 [exp]	1.7	0.9612
AT3G15730		PLDALPHA1	phospholipase D alpha 1 (.1)		Lus10018575 [exp]	1.7	0.9703
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10041055 [exp]	2.0	0.9689
AT3G21710			unknown protein		Lus10039666 [exp]	2.2	0.9561
AT2G02061			Nucleotide-diphospho-sugar tra...		Lus10031330 [exp]	4.0	0.9513
AT4G12300		CYP706A4	"cytochrome P450, family 706, ...		Lus10004331 [exp]	4.0	0.9562
AT5G14000	NAC	ANAC084	NAC domain containing protein ...		Lus10012557 [exp]	4.6	0.9516
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10020114 [exp]	4.9	0.9316
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10020115 [exp]	5.5	0.9557
AT2G17080			Arabidopsis protein of unknown...		Lus10014447 [exp]	5.7	0.9270

Compare expression of checked genes

Lus10002419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.