Lus10002420 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02550 59 / 4e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G36659 56 / 4e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G23350 49 / 7e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G47340 49 / 1e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G53840 45 / 4e-05 ATPME1 pectin methylesterase 1 (.1)
AT3G14300 45 / 6e-05 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001448 218 / 3e-72 AT1G23350 48 / 7e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10025021 187 / 8e-57 AT3G14300 63 / 2e-10 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
Lus10010002 184 / 3e-54 AT3G14300 / A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1)
Lus10031132 44 / 6e-05 AT1G62760 135 / 3e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 42 / 0.0002 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10037458 42 / 0.0004 AT3G14310 491 / 2e-170 pectin methylesterase 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G119200 115 / 1e-30 AT1G02550 97 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G194800 102 / 1e-25 AT1G02550 87 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G194900 101 / 2e-25 AT1G02550 87 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G119400 102 / 1e-24 AT1G02550 78 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G195000 88 / 2e-20 AT1G02550 76 / 3e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G010464 47 / 7e-06 AT5G27870 619 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.013G013400 45 / 4e-05 AT3G05610 580 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10002420 pacid=23179445 polypeptide=Lus10002420 locus=Lus10002420.g ID=Lus10002420.BGIv1.0 annot-version=v1.0
ATGACAACGAACCAACCAGAACACAAACACATGAACAGCCAAATAGAAAAGAAATTAGAAGATGACGGAGAAAGTGATGGCGATAAAGAAAAATCAAAAA
ATAAGGAGAAGAGTAAAGATGATGAAGAGAAAAAGAAATCCAAAGAAGACGATTCAATAGAGAAAAATGACGATGATGAAACAAAAAAGAAATCAAAAGA
CGATAGAGAAAAAGATGACGGTGAAGGTAAAGAAGAAAAATCAAAAGATAAGGAGAAAAGTGAAGATGATGAAGAAAAAAAGAAATTCGAAGAAGATGGT
TCAGAAGAAGAAAATGATAGCGATGAAAACAAAAAGGAATCAGAAGATTATGGAGAAAGAGACGATGATGAAGAAAAACAAAACAAATCAAAAGACGATA
GTGAAACAGAGAAAAATGAAAAGTTAACATCAACAAAAGATTTCGTTAGTGTAAAAAAAATATGTGGCACAACAGAATATCCAAAAGACTGTTTAAACTC
AATCTCACCTTTCATATCGGGGGCCACAGATCATGTGTCGATATTGAAGATGGAGATCAAGGCAATTAAAAAGGGGTTTGTAACATCAATTGCAAAGGCA
AAGAAGATGAGGAAGGATACAAACCGGAAGATAGATAAGAGCACAATTGATTCATGTGTCGAGAACTTCAATAGCGGTCTCACGGATCTTGAGAATGCGG
TAGATGCGATAAATGACCACGATCGATACTCATTACAGATCATGTTGAGTTCCATTCTAACGTACATTTCAACGTGTGAGGATGCAATAGGCGAGGATCA
AGACTCTTCCCTCCCAAGCATAACTCTAATGGAACACAAGTTGACAAACCTTGTTACCAATTGCATGGATTTGGCCGACCAATTTAATTGA
AA sequence
>Lus10002420 pacid=23179445 polypeptide=Lus10002420 locus=Lus10002420.g ID=Lus10002420.BGIv1.0 annot-version=v1.0
MTTNQPEHKHMNSQIEKKLEDDGESDGDKEKSKNKEKSKDDEEKKKSKEDDSIEKNDDDETKKKSKDDREKDDGEGKEEKSKDKEKSEDDEEKKKFEEDG
SEEENDSDENKKESEDYGERDDDEEKQNKSKDDSETEKNEKLTSTKDFVSVKKICGTTEYPKDCLNSISPFISGATDHVSILKMEIKAIKKGFVTSIAKA
KKMRKDTNRKIDKSTIDSCVENFNSGLTDLENAVDAINDHDRYSLQIMLSSILTYISTCEDAIGEDQDSSLPSITLMEHKLTNLVTNCMDLADQFN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G36659 Plant invertase/pectin methyle... Lus10002420 0 1
AT4G01575 serine protease inhibitor, Kaz... Lus10010094 1.0 0.8257
AT5G20240 MADS PI, PISTILLATA PISTILLATA, K-box region and M... Lus10029719 42.6 0.6665
AT4G18960 MADS AG AGAMOUS, K-box region and MADS... Lus10007324 44.9 0.6663
AT1G69120 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-bo... Lus10005081 47.2 0.6658
AT5G59700 Protein kinase superfamily pro... Lus10023324 50.1 0.6208
AT2G32940 AGO6 ARGONAUTE 6, Argonaute family ... Lus10015155 51.0 0.6651
Lus10011636 56.9 0.6643
AT3G16970 Plant self-incompatibility pro... Lus10011753 59.2 0.6643
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10011892 61.5 0.6643
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000558 63.6 0.6643

Lus10002420 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.