Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G02560 354 / 3e-123 NCLPP5, NCLPP1, CLPP5 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) AT1G66670 190 / 7e-59 NCLPP3, NCLPP4, CLPP3 CLP protease proteolytic subunit 3 (.1) AT5G23140 179 / 1e-55 NCLPP7, NCLPP2, CLPP2 nuclear-encoded CLP protease P7 (.1) AT5G45390 178 / 2e-54 NCLPP3, NCLPP4, CLPP4 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) AT1G11750 155 / 8e-46 NCLPP6, NCLPP1, CLPP6 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) ATCG00670 146 / 3e-43 PCLPP, ATCG00670.1, CLPP1 CASEINOLYTIC PROTEASE P 1, plastid-encoded CLP P (.1) AT1G12410 142 / 7e-41 EMB3146, CLP2, NCLPP2, CLPR2 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) AT1G09130 118 / 6e-31 ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.1), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.2), ATP-dependent caseinolytic (Clp) protease/crotonase family protein (.3) AT4G17040 112 / 4e-29 HON5, CLPR4 happy on norflurazon 5, CLP protease R subunit 4 (.1) AT1G49970 96 / 1e-22 SVR2, NCLPP5, CLPR1 SUPPRESSOR OF VARIEGATION 2, NUCLEAR CLPP 5, CLP protease proteolytic subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001450 [exp] 516 / 0 AT1G02560 365 / 1e-126 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10010003 [exp] 286 / 6e-97 AT1G02560 308 / 2e-105 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10025022 [exp] 286 / 1e-96 AT1G02560 313 / 3e-107 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Lus10010196 [exp] 177 / 1e-54 AT5G23140 395 / 4e-141 nuclear-encoded CLP protease P7 (.1) Lus10017397 [exp] 176 / 5e-54 AT5G23140 394 / 1e-140 nuclear-encoded CLP protease P7 (.1) Lus10010979 [exp] 174 / 2e-52 AT1G66670 288 / 6e-97 CLP protease proteolytic subunit 3 (.1) Lus10000449 [exp] 172 / 9e-52 AT1G66670 285 / 1e-95 CLP protease proteolytic subunit 3 (.1) Lus10040981 [exp] 171 / 1e-51 AT5G23140 350 / 1e-122 nuclear-encoded CLP protease P7 (.1) Lus10013434 [exp] 169 / 8e-51 AT5G23140 347 / 3e-121 nuclear-encoded CLP protease P7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G119700 [exp] 370 / 2e-129 AT1G02560 493 / 6e-178 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.002G195200 [exp] 354 / 3e-123 AT1G02560 474 / 2e-170 NUCLEAR CLPP 5, NUCLEAR-ENCODED CLPP 1, nuclear encoded CLP protease 5 (.1) Potri.004G092100 [exp] 200 / 2e-62 AT1G66670 441 / 2e-156 CLP protease proteolytic subunit 3 (.1) Potri.007G071700 [exp] 180 / 4e-55 AT5G23140 383 / 1e-135 nuclear-encoded CLP protease P7 (.1) Potri.005G092600 [exp] 175 / 6e-54 AT5G23140 380 / 3e-135 nuclear-encoded CLP protease P7 (.1) Potri.003G103300 [exp] 168 / 2e-50 AT5G45390 383 / 9e-135 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1) Potri.004G152900 [exp] 163 / 5e-49 AT1G11750 397 / 4e-141 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.009G114001 [exp] 162 / 1e-48 AT1G11750 353 / 2e-123 NUCLEAR-ENCODED CLPP 1, CLP protease proteolytic subunit 6 (.1.2) Potri.001G115900 [exp] 142 / 7e-41 AT1G12410 408 / 3e-145 NUCLEAR-ENCODED CLP PROTEASE P2, EMBRYO DEFECTIVE 3146, CLP protease proteolytic subunit 2 (.1) Potri.001G130601 [exp] 132 / 1e-37 AT5G45390 239 / 2e-79 NUCLEAR-ENCODED CLP PROTEASE P4, CLP protease P4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0127 [flax] [poplar] ClpP_crotonase PF00574 [flax] [poplar] CLP_protease Clp protease
Representative CDS sequence Show only first row Show all	>Lus10002422 pacid=23179434 polypeptide=Lus10002422 locus=Lus10002422.g ID=Lus10002422.BGIv1.0 annot-version=v1.0 ATGTCTATGGCACACTCCTCATTCTCTTCTTCAGCTGGCCTCGGCTCTCTTGTCTTCTCCCCAAACCCTATCTCCTCTCCCAATCCTCGCAACCTTGCTC TTCCCTTCCGCCCTCTCACCTCCTCCAGGAAATTGAGCAAGTCGGACAAAATCACTCTTCGGACTGCCGCTTACTCCACCTCCGAACTCCCTGATACGAG TTCTCGCCGCGGACTTTGGTCAATTAGGGATGATTTGGAAATCCCATCTTCGTCTTACTTCCCCACACTTGCCAGTGGGGCTGAAGCTAAAGGACCGCGT TCCCCGCGGCTTGGCAGTGTCATTAACCAGCTTTTTCAATATAGAATTATAAGATGCGGTGGACCCGTTGAGGACGATATGGCCAACATTATTGTTGCAC AACTTCTCTATCTCGATGCAGTTGATCCTAATAAGGATATCATCATGTATGTCAACAGTCCAGGCGGATCAGTCACAGCTGGCATGGCGATTTTTGACAC CATGAAGCATATCCGACCTGATGTCTCTACTATTTGTGTTGGTCTTGCTGCTAGTATGGGAGCTTTTCTGCTTAGTGCTGGAACCAAAGGTAAAAGATAC AGCCTGCCAAATTCGAGGATGATGATCCATCAACCTATCGGTGGAACTTCAGGTTCACAGACCGACTTTGCAAATCAGGTTAACGAGATGTTGCATCATA AAAAGAACCTGAGTAGCTATCTGGCCTACCAAACTGGTCAAAGTTACGAGAAGGTGAACGATGACACTGAACTCGATTACTTCATGGGAGCAGAGGAAGC GAAAGCGTACGGACTTATCGATGATGTGATCGTGAGCCCTTTCAAACTTTCTCTTAGTTAG
AA sequence Show only first row Show all	>Lus10002422 pacid=23179434 polypeptide=Lus10002422 locus=Lus10002422.g ID=Lus10002422.BGIv1.0 annot-version=v1.0 MSMAHSSFSSSAGLGSLVFSPNPISSPNPRNLALPFRPLTSSRKLSKSDKITLRTAAYSTSELPDTSSRRGLWSIRDDLEIPSSSYFPTLASGAEAKGPR SPRLGSVINQLFQYRIIRCGGPVEDDMANIIVAQLLYLDAVDPNKDIIMYVNSPGGSVTAGMAIFDTMKHIRPDVSTICVGLAASMGAFLLSAGTKGKRY SLPNSRMMIHQPIGGTSGSQTDFANQVNEMLHHKKNLSSYLAYQTGQSYEKVNDDTELDYFMGAEEAKAYGLIDDVIVSPFKLSLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G02560		NCLPP5, NCLPP1,...	NUCLEAR CLPP 5, NUCLEAR-ENCODE...		Lus10002422 [exp]	0	1
AT1G36390			Co-chaperone GrpE family prote...		Lus10024760 [exp]	2.4	0.8694
AT5G27390			Mog1/PsbP/DUF1795-like photosy...		Lus10031517 [exp]	2.8	0.8812
AT1G02560		NCLPP5, NCLPP1,...	NUCLEAR CLPP 5, NUCLEAR-ENCODE...		Lus10010003 [exp]	4.5	0.8589
AT1G67660			Restriction endonuclease, type...		Lus10006437 [exp]	8.2	0.8315
AT4G34290			SWIB/MDM2 domain superfamily p...		Lus10002106 [exp]	8.2	0.8719
AT1G02560		NCLPP5, NCLPP1,...	NUCLEAR CLPP 5, NUCLEAR-ENCODE...		Lus10025022 [exp]	8.7	0.8343
AT3G24590		PLSP1	plastidic type i signal peptid...		Lus10034925 [exp]	8.8	0.8212
AT3G21200		PGR7	proton gradient regulation 7 (...		Lus10035751 [exp]	13.7	0.8440
AT2G23820			Metal-dependent phosphohydrola...		Lus10019968 [exp]	14.0	0.8391
AT2G43630			unknown protein		Lus10005311 [exp]	16.2	0.8399

Compare expression of checked genes

Lus10002422 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.