Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47400 125 / 4e-38 CP12-1 CP12 domain-containing protein 1 (.1) AT3G62410 117 / 4e-35 CP12-2 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) AT1G76560 83 / 3e-21 CP12-3 CP12 domain-containing protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001453 [exp] 234 / 2e-81 AT2G47400 126 / 1e-38 CP12 domain-containing protein 1 (.1) Lus10025025 [exp] 159 / 1e-51 AT2G47400 125 / 2e-38 CP12 domain-containing protein 1 (.1) Lus10010006 [exp] 91 / 9e-25 AT2G47400 59 / 4e-12 CP12 domain-containing protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G120700 [exp] 139 / 7e-44 AT3G62410 122 / 5e-37 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) Potri.002G196100 [exp] 130 / 2e-40 AT3G62410 89 / 8e-24 CP12 DOMAIN-CONTAINING PROTEIN 1, CP12 domain-containing protein 2 (.1) Potri.005G258400 [exp] 79 / 1e-19 AT1G76560 114 / 1e-33 CP12 domain-containing protein 3 (.1) Potri.002G002700 [exp] 77 / 3e-19 AT1G76560 109 / 1e-31 CP12 domain-containing protein 3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02672 [flax] [poplar] CP12 CP12 domain
Representative CDS sequence Show only first row Show all	>Lus10002428 pacid=23179453 polypeptide=Lus10002428 locus=Lus10002428.g ID=Lus10002428.BGIv1.0 annot-version=v1.0 ATGGCGGCCGGCCTCACCCTGTCAACCTCTCCGGCAAGCTGGAAGGCGAGGATGTTAGCAACAACTGCAACGACACCGAAACAACAGCCGTTTCTGTGCA TGAAGAAGCAGCAGAGGGTGGTGGTGATGAGAGCGGTGCCGGATAAGATTCAAGAAAAAGTAGAAGAGAGCATTAAGGCGGCGGAGGAGACTTGCGGTGA GGATCCGGCGAGCGGGGAGTGCGTAGCGGCGTGGGACGAGGTGGAGGAGCTCAGCGCAGCCGCCAGCCACGCTAGGGACAAGAAGAAGGGGTACGACCCG CTTGAAGCTTACTGCCAGGACAACCCGGAGACCGACGAGTGCCGCACCTACGATAACTAG
AA sequence Show only first row Show all	>Lus10002428 pacid=23179453 polypeptide=Lus10002428 locus=Lus10002428.g ID=Lus10002428.BGIv1.0 annot-version=v1.0 MAAGLTLSTSPASWKARMLATTATTPKQQPFLCMKKQQRVVVMRAVPDKIQEKVEESIKAAEETCGEDPASGECVAAWDEVEELSAAASHARDKKKGYDP LEAYCQDNPETDECRTYDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47400		CP12-1	CP12 domain-containing protein...		Lus10002428 [exp]	0	1
AT2G47400		CP12-1	CP12 domain-containing protein...		Lus10010006 [exp]	1.0	0.9394
AT3G10910			RING/U-box superfamily protein...		Lus10029037 [exp]	3.7	0.9251
AT4G40070			RING/U-box superfamily protein...		Lus10034157 [exp]	5.7	0.9072
AT4G40070			RING/U-box superfamily protein...		Lus10043426 [exp]	7.1	0.9084
AT3G06483		ATPDHK, PDK	pyruvate dehydrogenase kinase ...		Lus10018337 [exp]	9.5	0.9064
AT2G01590		CRR3	chlororespiratory reduction 3 ...		Lus10027792 [exp]	11.7	0.8922
AT4G26860			Predicted pyridoxal phosphate-...		Lus10032558 [exp]	13.3	0.8808
AT5G51260			HAD superfamily, subfamily III...		Lus10038847 [exp]	14.7	0.8997
AT4G26530			Aldolase superfamily protein (...		Lus10005850 [exp]	15.2	0.8889
AT3G52155			Phosphoglycerate mutase family...		Lus10023521 [exp]	15.6	0.8221

Compare expression of checked genes

Lus10002428 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.