Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G61310 80 / 5e-22 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) AT2G47380 80 / 7e-22 Cytochrome c oxidase subunit Vc family protein (.1) AT5G40382 70 / 6e-18 Cytochrome c oxidase subunit Vc family protein (.1) AT3G62400 40 / 5e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010008 [exp] 102 / 1e-30 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10001454 [exp] 102 / 1e-30 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10025028 [exp] 100 / 5e-30 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10040012 [exp] 95 / 7e-28 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10022249 [exp] 71 / 3e-18 AT5G40382 91 / 3e-26 Cytochrome c oxidase subunit Vc family protein (.1) Lus10008765 [exp] 64 / 2e-15 AT5G40382 92 / 6e-27 Cytochrome c oxidase subunit Vc family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G195901 [exp] 86 / 2e-24 AT5G61310 94 / 2e-27 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Potri.014G120500 [exp] 85 / 4e-24 AT5G61310 103 / 3e-31 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10002429 pacid=23179442 polypeptide=Lus10002429 locus=Lus10002429.g ID=Lus10002429.BGIv1.0 annot-version=v1.0 ATGGCTGGCAGGATCCCACATCCGACACTGAAAGGACCAAGCGTTATCAAGGAGATAGTGATCGGGATTGCCCTTGGCATGGCTGCTGGTGGTCTTTGGA AGATGCATCACTGGAATGAGCAGAGGAAAGTAAGAGCATTCTATGACATGCTTGAAAAAGGTGAAATCAGTGTCGTTGCTGAAGAATAG
AA sequence Show only first row Show all	>Lus10002429 pacid=23179442 polypeptide=Lus10002429 locus=Lus10002429.g ID=Lus10002429.BGIv1.0 annot-version=v1.0 MAGRIPHPTLKGPSVIKEIVIGIALGMAAGGLWKMHHWNEQRKVRAFYDMLEKGEISVVAEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G61310			Cytochrome c oxidase subunit V...		Lus10002429 [exp]	0	1
AT5G61310			Cytochrome c oxidase subunit V...		Lus10025028 [exp]	1.0	0.8865
AT1G07960		ATPDIL5-1	PDI-like 5-1 (.1.2.3)		Lus10036125 [exp]	2.4	0.8770
AT1G21900			emp24/gp25L/p24 family/GOLD fa...		Lus10041939 [exp]	4.5	0.8478
AT1G32210		ATDAD1	DEFENDER AGAINST APOPTOTIC DEA...		Lus10010413 [exp]	4.9	0.8250
AT2G18390		HAL, ARL2, TTN5...	TITAN 5, HALLIMASCH, ARF-LIKE ...		Lus10042271 [exp]	6.5	0.8036
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10017043 [exp]	7.2	0.7986
AT3G06610			DNA-binding enhancer protein-r...		Lus10037773 [exp]	11.0	0.8261
AT1G15270			Translation machinery associat...		Lus10037543 [exp]	12.2	0.8586
AT2G23940			Protein of unknown function (D...		Lus10041903 [exp]	14.0	0.8278
AT3G50860			Clathrin adaptor complex small...		Lus10024011 [exp]	14.1	0.7680

Compare expression of checked genes

Lus10002429 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.