Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38700 51 / 5e-09 unknown protein AT4G02170 48 / 6e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001456 [exp] 115 / 7e-34 AT5G38700 132 / 4e-39 unknown protein Lus10010019 [exp] 64 / 1e-13 AT5G38700 164 / 8e-52 unknown protein Lus10025041 [exp] 56 / 8e-11 AT5G38700 150 / 2e-46 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G123400 [exp] 50 / 1e-08 AT5G38700 144 / 4e-44 unknown protein Potri.002G198800 [exp] 49 / 3e-08 AT5G38700 157 / 3e-49 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002433 pacid=23179454 polypeptide=Lus10002433 locus=Lus10002433.g ID=Lus10002433.BGIv1.0 annot-version=v1.0 ATGCACCATCATAGCCCTGCAGCTTCCTTGCGCTTCATATTCTCCTGCATTGTGCCCAGCTGCCCTGCTGATTCTTTCGACTTTGACGATTGTGATTACC TCCACAAGCAATGCACCTTTGATGACGATGTGGAGGAGGAGTTTGAAGAGCAATCCGAGGAGGAGAGTTCATTTGATTCAAGCTCAGAAGAGGATTATGA GGAGGAGGAAAGTGAAGGGGTGGACTCAAGAGCTGACAAGTTCATAGCTCAGTTCTACCAGCAGATGAAGCTACAGAGACAAATTTCATACTTAGAGTAC CACAAATGA
AA sequence Show only first row Show all	>Lus10002433 pacid=23179454 polypeptide=Lus10002433 locus=Lus10002433.g ID=Lus10002433.BGIv1.0 annot-version=v1.0 MHHHSPAASLRFIFSCIVPSCPADSFDFDDCDYLHKQCTFDDDVEEEFEEQSEEESSFDSSSEEDYEEEESEGVDSRADKFIAQFYQQMKLQRQISYLEY HK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38700			unknown protein		Lus10002433 [exp]	0	1
AT4G16120		ATSEB1, COBL7	ARABIDOPSIS THALIANA SEC61 BET...		Lus10016847 [exp]	1.0	0.9753
AT1G12610	AP2_ERF	DDF1, DREB1F, F...	DWARF AND DELAYED FLOWERING 1,...		Lus10006334 [exp]	2.4	0.9707
AT1G17420		ATLOX3, LOX3	Arabidopsis thaliana lipoxygen...		Lus10008113 [exp]	2.6	0.9545
AT3G03280			unknown protein		Lus10007960 [exp]	2.8	0.9593
AT4G34320			Protein of unknown function (D...		Lus10040489 [exp]	3.2	0.9590
AT3G54100			O-fucosyltransferase family pr...		Lus10021119 [exp]	3.5	0.9640
AT1G07160			Protein phosphatase 2C family ...		Lus10026381 [exp]	4.7	0.9508
AT1G12610	AP2_ERF	DDF1, DREB1F, F...	DWARF AND DELAYED FLOWERING 1,...		Lus10006332 [exp]	4.9	0.9541
AT1G12610	AP2_ERF	DDF1, DREB1F, F...	DWARF AND DELAYED FLOWERING 1,...		Lus10001871 [exp]	5.2	0.9538
AT1G29290			unknown protein		Lus10007309 [exp]	5.3	0.9436

Compare expression of checked genes

Lus10002433 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.