Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26990 95 / 3e-25 Drought-responsive family protein (.1) AT3G05700 92 / 4e-24 Drought-responsive family protein (.1) AT1G02750 87 / 2e-22 Drought-responsive family protein (.1.2) AT3G06760 86 / 5e-22 Drought-responsive family protein (.1.2) AT4G02200 85 / 1e-21 Drought-responsive family protein (.1.2.3) AT5G49230 80 / 1e-19 HRB1 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) AT1G56280 73 / 6e-17 ATDI19 drought-induced 19 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001462 [exp] 229 / 5e-78 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1) Lus10013420 [exp] 137 / 7e-42 AT3G06760 124 / 3e-35 Drought-responsive family protein (.1.2) Lus10010305 [exp] 132 / 5e-40 AT3G06760 108 / 5e-29 Drought-responsive family protein (.1.2) Lus10031467 [exp] 108 / 1e-30 AT5G26990 253 / 1e-85 Drought-responsive family protein (.1) Lus10037819 [exp] 82 / 3e-20 AT5G49230 198 / 3e-64 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Lus10015412 [exp] 72 / 3e-16 AT5G26990 123 / 1e-34 Drought-responsive family protein (.1) Lus10015214 [exp] 69 / 1e-15 AT5G26990 194 / 5e-63 Drought-responsive family protein (.1) Lus10017956 [exp] 66 / 7e-14 AT5G26990 74 / 8e-15 Drought-responsive family protein (.1) Lus10017097 [exp] 50 / 3e-08 AT5G49230 131 / 2e-38 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G011200 [exp] 107 / 3e-30 AT3G05700 250 / 1e-84 Drought-responsive family protein (.1) Potri.005G020900 [exp] 107 / 3e-30 AT3G05700 224 / 3e-74 Drought-responsive family protein (.1) Potri.010G000800 [exp] 91 / 9e-24 AT5G49230 190 / 5e-61 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.008G213400 [exp] 90 / 2e-23 AT5G49230 196 / 2e-63 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.014G125500 [exp] 89 / 6e-23 AT3G05700 148 / 2e-44 Drought-responsive family protein (.1) Potri.011G057200 [exp] 83 / 1e-20 AT3G06760 110 / 2e-29 Drought-responsive family protein (.1.2) Potri.019G027300 [exp] 79 / 2e-20 AT5G49230 123 / 1e-36 HYPERSENSITIVE TO RED AND BLUE, Drought-responsive family protein (.1) Potri.002G200500 [exp] 78 / 8e-19 AT3G05700 152 / 7e-46 Drought-responsive family protein (.1) Potri.012G086500 [exp] 53 / 2e-09 AT1G56280 92 / 6e-23 drought-induced 19 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0361 [flax] [poplar] C2H2-zf PF05605 [flax] [poplar] zf-Di19 Drought induced 19 protein (Di19), zinc-binding
Representative CDS sequence Show only first row Show all	>Lus10002441 pacid=23179451 polypeptide=Lus10002441 locus=Lus10002441.g ID=Lus10002441.BGIv1.0 annot-version=v1.0 ATGGATGACGATAAGTGGAGCATCGACCTCTCTTCTACTTCCTCTTCTAGGGCTTATCAGCACGATCCTAAGTTTTTATCTGATCTTTGCGTTGATTTTG AGTCACTAGAAGACACAGATGAGTATTTGATGGCGGAATATCCTTGCCCCTATTGCGAAGAGGATTTTGATTTGGTTGATTTGTGCTGCCATATAGATGA TGAACATCAGTTCGAATCCAGGTCGGAGATGTGTCCAGTTTGTGGCCTAAATGAGGCTATGGACATGGTTTTCCACATAACATCACAACATGGAGATATG TTTAAGATATCCTTGGCAGTCGGCACCATTTTGGTTTAG
AA sequence Show only first row Show all	>Lus10002441 pacid=23179451 polypeptide=Lus10002441 locus=Lus10002441.g ID=Lus10002441.BGIv1.0 annot-version=v1.0 MDDDKWSIDLSSTSSSRAYQHDPKFLSDLCVDFESLEDTDEYLMAEYPCPYCEEDFDLVDLCCHIDDEHQFESRSEMCPVCGLNEAMDMVFHITSQHGDM FKISLAVGTILV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G26990			Drought-responsive family prot...		Lus10002441 [exp]	0	1
AT1G78010			tRNA modification GTPase, puta...		Lus10006309 [exp]	36.9	0.6104
AT5G17260	NAC	ANAC086	NAC domain containing protein ...		Lus10007216 [exp]	42.1	0.5952

Compare expression of checked genes

Lus10002441 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.