Lus10002467 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10002467 pacid=23162240 polypeptide=Lus10002467 locus=Lus10002467.g ID=Lus10002467.BGIv1.0 annot-version=v1.0
ATGGCGAACTCGTCTTCTTCGCGGTCTTCAAGTGTAAGACCTCCAACTCCTTCCTCCATAGCAGCATCGGCCGCAGTGGTGGTGATCATGGCCATTGATC
CGACGGTCGTGGCGGGGCATTTGGATAAACAGGATGAGCTGTTGAGTGAAGTTTTTGATTCAATGAACAATGAACTGAGCAAGCTCCTGAACGAAGATGA
ACAGAATCCCGATGATGGCCAAATTGGGCAGACAACACCTTTGCCAACCTGCGGAAAGAACAAGTCTGATGTTGATAAAGCTGAAACTGTGAAACCCAGC
AAGGATACTTAA
AA sequence
>Lus10002467 pacid=23162240 polypeptide=Lus10002467 locus=Lus10002467.g ID=Lus10002467.BGIv1.0 annot-version=v1.0
MANSSSSRSSSVRPPTPSSIAASAAVVVIMAIDPTVVAGHLDKQDELLSEVFDSMNNELSKLLNEDEQNPDDGQIGQTTPLPTCGKNKSDVDKAETVKPS
KDT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002467 0 1
AT2G47600 ATMHX1, ATMHX MAGNESIUM/PROTON EXCHANGER 1, ... Lus10030365 2.6 0.7123
AT5G34850 ATPAP26, PAP26 purple acid phosphatase 26 (.1... Lus10008054 5.7 0.6764
AT1G77920 bZIP bZIP transcription factor fami... Lus10018009 21.7 0.6820
AT1G73760 RING/U-box superfamily protein... Lus10007967 29.0 0.6347
AT2G02230 ATPP2-B1 phloem protein 2-B1 (.1) Lus10042713 37.8 0.6519
AT4G23630 RTNLB1, BTI1 Reticulan like protein B1, VIR... Lus10019125 37.9 0.5873
AT5G65020 ANNAT2 annexin 2 (.1.2) Lus10041696 39.5 0.6060
AT4G02050 STP7 sugar transporter protein 7 (.... Lus10036325 39.7 0.6272
AT4G24050 NAD(P)-binding Rossmann-fold s... Lus10003204 46.9 0.5955
AT3G21180 ATACA9, ACA9 autoinhibited Ca\(2+\)-ATPase ... Lus10034840 47.1 0.6179

Lus10002467 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.