Lus10002470 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22610 64 / 2e-12 Di-glucose binding protein with Kinesin motor domain (.1.2)
AT1G07750 50 / 2e-07 RmlC-like cupins superfamily protein (.1)
AT2G28680 49 / 2e-07 RmlC-like cupins superfamily protein (.1)
AT1G72250 49 / 3e-07 Di-glucose binding protein with Kinesin motor domain (.1.2)
AT4G12570 41 / 0.0001 UPL5 ubiquitin protein ligase 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010493 74 / 1e-15 AT4G12570 830 / 0.0 ubiquitin protein ligase 5 (.1)
Lus10003792 73 / 1e-15 AT4G12570 409 / 3e-136 ubiquitin protein ligase 5 (.1)
Lus10035954 69 / 6e-14 AT2G22610 1302 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2)
Lus10025708 69 / 8e-14 AT2G22610 1238 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2)
Lus10005438 55 / 3e-09 AT1G07750 569 / 0.0 RmlC-like cupins superfamily protein (.1)
Lus10015219 54 / 4e-09 AT1G07750 568 / 0.0 RmlC-like cupins superfamily protein (.1)
Lus10005582 54 / 1e-08 AT1G72250 1109 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2)
Lus10013714 54 / 1e-08 AT1G72250 1098 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G110600 63 / 6e-12 AT2G22610 1057 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2)
Potri.016G012900 59 / 1e-10 AT4G12570 853 / 0.0 ubiquitin protein ligase 5 (.1)
Potri.001G436200 56 / 2e-09 AT1G72250 1248 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2)
Potri.011G140000 54 / 5e-09 AT1G72250 1201 / 0.0 Di-glucose binding protein with Kinesin motor domain (.1.2)
Potri.016G059800 54 / 7e-09 AT4G12570 733 / 0.0 ubiquitin protein ligase 5 (.1)
Potri.006G011701 53 / 1e-08 AT4G12570 842 / 0.0 ubiquitin protein ligase 5 (.1)
Potri.007G047200 52 / 2e-08 AT2G28680 561 / 0.0 RmlC-like cupins superfamily protein (.1)
Potri.008G102900 51 / 5e-08 AT2G28680 543 / 0.0 RmlC-like cupins superfamily protein (.1)
Potri.013G020700 40 / 0.0003 AT5G27550 862 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10002470 pacid=23159286 polypeptide=Lus10002470 locus=Lus10002470.g ID=Lus10002470.BGIv1.0 annot-version=v1.0
ATGGCATGCTCAGGCAACATCGGTGCCACCAAGCTCGGCCTCGAGAAGAACGGCTTGGCCCTCCCTTGCTACTTCGACTCCACTAAGGTCGCCTACGTTC
CTCAAGGGGTTGTAGAAGCAAACGCTGATAACATCAAATATGTTTGGAGTGTAATACAGGTTGGAAGCAATTCCAAGGCTGTTGGTTCAAACAATATCAA
TGAACATAGAAGCCGATCTCATTGGAACATTGTAGAACACCGCTCTGGAGGGAAAAAAAGCATCGTAGTGAATAGCAAGAATAGAGTGGAGTACATAACC
CCTCTGGTTCGGCATCAATTTGCCACATTTATCTCTGAACAGGCTCCGCATTTTGCAAAAGCCTTAACTGATATTCTAGCTCTCAGTTTCGACAAAGTTT
CAACAGAACAAGCTCATCATCGATATGTTCTTACTTATGCTCTCCTAATTCAAGATAACTTTGCTGCATATATTGTTTCATTTGGATGA
AA sequence
>Lus10002470 pacid=23159286 polypeptide=Lus10002470 locus=Lus10002470.g ID=Lus10002470.BGIv1.0 annot-version=v1.0
MACSGNIGATKLGLEKNGLALPCYFDSTKVAYVPQGVVEANADNIKYVWSVIQVGSNSKAVGSNNINEHRSRSHWNIVEHRSGGKKSIVVNSKNRVEYIT
PLVRHQFATFISEQAPHFAKALTDILALSFDKVSTEQAHHRYVLTYALLIQDNFAAYIVSFG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G22610 Di-glucose binding protein wit... Lus10002470 0 1

Lus10002470 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.