Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05570 72 / 7e-16 transducin family protein / WD-40 repeat family protein (.1.2) AT4G35560 41 / 4e-05 DAW1 DUO1-activated WD40 1, Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001254 [exp] 146 / 2e-46 AT5G05570 85 / 9e-20 transducin family protein / WD-40 repeat family protein (.1.2) Lus10027810 [exp] 96 / 2e-26 AT5G05570 84 / 2e-19 transducin family protein / WD-40 repeat family protein (.1.2) Lus10009082 [exp] 81 / 4e-19 AT5G05570 358 / 6e-106 transducin family protein / WD-40 repeat family protein (.1.2) Lus10037841 [exp] 56 / 5e-10 AT5G05570 1009 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Lus10030399 [exp] 56 / 5e-10 AT5G05570 977 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Lus10005040 [exp] 48 / 5e-08 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G117800 [exp] 89 / 7e-22 AT5G05570 900 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Potri.016G117700 [exp] 75 / 7e-19 AT5G05570 90 / 3e-22 transducin family protein / WD-40 repeat family protein (.1.2) Potri.006G101600 [exp] 72 / 1e-17 AT5G05570 72 / 8e-16 transducin family protein / WD-40 repeat family protein (.1.2) Potri.010G187700 [exp] 71 / 2e-15 AT5G05570 1069 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Potri.008G069700 [exp] 55 / 5e-10 AT5G05570 624 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2) Potri.005G101600 [exp] 43 / 1e-05 AT4G35560 1037 / 0.0 DUO1-activated WD40 1, Transducin/WD40 repeat-like superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002478 pacid=23170170 polypeptide=Lus10002478 locus=Lus10002478.g ID=Lus10002478.BGIv1.0 annot-version=v1.0 ATGCTCTGCGGCTGTCTTTCTGAGTCTCAATCTTACAAGAGCCCTTCGCCGGTGGCAAAAGCATCATCATCATCCCTTGAAAGGGCACAGCTTTTAGGTT CCAAAGATGCAACAAGGTCTAAACCAATGAATCCAGACGAAATCAGATCCAAGTATCGAAAATCTGATAATGTGAAGTCAGCTGCTACCCATGCGAAGAA CAAGCTTGTAGAGAGGAAAGAAAAGCTCGAGAAAATCAGTCTGCGGTCAGCGGAGTTGGAAGGAAGAGCACAAGACTATGCATCGATGGCAAAGGAGCTT GCTGACATAATGGAGAAGAGGAAGTAA
AA sequence Show only first row Show all	>Lus10002478 pacid=23170170 polypeptide=Lus10002478 locus=Lus10002478.g ID=Lus10002478.BGIv1.0 annot-version=v1.0 MLCGCLSESQSYKSPSPVAKASSSSLERAQLLGSKDATRSKPMNPDEIRSKYRKSDNVKSAATHAKNKLVERKEKLEKISLRSAELEGRAQDYASMAKEL ADIMEKRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05570			transducin family protein / WD...		Lus10002478 [exp]	0	1
AT5G35390			Leucine-rich repeat protein ki...		Lus10022946 [exp]	13.1	0.6872
AT5G56180		ATARP8	actin-related protein 8 (.1.2)		Lus10025605 [exp]	30.1	0.6591
AT3G26100			Regulator of chromosome conden...		Lus10011399 [exp]	77.4	0.6020
AT4G02780		ATCPS1, ABC33, ...	GA REQUIRING 1, CPP synthase, ...		Lus10004323 [exp]	80.0	0.5478
AT2G28390			SAND family protein (.1)		Lus10021472 [exp]	88.5	0.5955
AT1G65770		AMR1	ascorbic acid mannose pathway ...		Lus10028385 [exp]	144.3	0.5703
AT5G06820		SRF2	STRUBBELIG-receptor family 2 (...		Lus10016276 [exp]	174.3	0.5575
AT3G05640			Protein phosphatase 2C family ...		Lus10016831 [exp]	212.9	0.5443

Compare expression of checked genes

Lus10002478 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.