Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38250 91 / 4e-24 Trihelix Homeodomain-like superfamily protein (.1) AT5G01380 91 / 8e-24 Trihelix Homeodomain-like superfamily protein (.1) AT1G13450 59 / 3e-12 Trihelix GT-1 GT-1, Homeodomain-like superfamily protein (.1.2.3) AT3G25990 59 / 4e-12 Trihelix Homeodomain-like superfamily protein (.1) AT5G63420 44 / 6e-07 Trihelix EMB2746 embryo defective 2746, RNA-metabolising metallo-beta-lactamase family protein (.1) AT1G76890 44 / 7e-07 Trihelix AT-GT2, GT2 Duplicated homeodomain-like superfamily protein (.2) AT1G33240 42 / 3e-06 Trihelix AT-GTL2, AT-GTL1 GT2-LIKE 1, GT-2-like 1 (.1) AT5G47660 40 / 2e-05 Trihelix Homeodomain-like superfamily protein (.1) AT1G76880 40 / 2e-05 Trihelix Duplicated homeodomain-like superfamily protein (.1) AT5G28300 37 / 0.0002 Trihelix Duplicated homeodomain-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004806 [exp] 109 / 6e-31 AT5G01380 239 / 5e-77 Homeodomain-like superfamily protein (.1) Lus10015824 [exp] 56 / 7e-11 AT1G13450 533 / 0.0 GT-1, Homeodomain-like superfamily protein (.1.2.3) Lus10036978 [exp] 56 / 8e-11 AT1G13450 523 / 0.0 GT-1, Homeodomain-like superfamily protein (.1.2.3) Lus10020873 [exp] 45 / 4e-07 AT1G76890 320 / 2e-103 Duplicated homeodomain-like superfamily protein (.2) Lus10033504 [exp] 45 / 4e-07 AT1G76890 323 / 8e-105 Duplicated homeodomain-like superfamily protein (.2) Lus10029778 [exp] 42 / 3e-06 AT1G76890 311 / 3e-96 Duplicated homeodomain-like superfamily protein (.2) Lus10042806 [exp] 42 / 3e-06 AT1G76890 337 / 9e-108 Duplicated homeodomain-like superfamily protein (.2) Lus10018887 [exp] 41 / 7e-06 AT1G76880 451 / 1e-151 Duplicated homeodomain-like superfamily protein (.1) Lus10022454 [exp] 41 / 1e-05 AT5G63420 1223 / 0.0 embryo defective 2746, RNA-metabolising metallo-beta-lactamase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G117300 [exp] 91 / 5e-24 AT5G01380 179 / 2e-54 Homeodomain-like superfamily protein (.1) Potri.006G101400 [exp] 89 / 1e-23 AT5G01380 179 / 8e-55 Homeodomain-like superfamily protein (.1) Potri.001G129900 [exp] 81 / 2e-20 AT2G38250 115 / 4e-30 Homeodomain-like superfamily protein (.1) Potri.003G104500 [exp] 72 / 6e-17 AT2G38250 118 / 3e-31 Homeodomain-like superfamily protein (.1) Potri.010G055000 [exp] 60 / 2e-12 AT1G13450 518 / 0.0 GT-1, Homeodomain-like superfamily protein (.1.2.3) Potri.008G179700 [exp] 58 / 7e-12 AT1G13450 541 / 0.0 GT-1, Homeodomain-like superfamily protein (.1.2.3) Potri.001G454500 [exp] 45 / 4e-07 AT1G33240 186 / 1e-49 GT2-LIKE 1, GT-2-like 1 (.1) Potri.011G147400 [exp] 43 / 2e-06 AT1G33240 181 / 5e-48 GT2-LIKE 1, GT-2-like 1 (.1) Potri.005G192000 [exp] 42 / 3e-06 AT1G76890 392 / 6e-130 Duplicated homeodomain-like superfamily protein (.2) Potri.002G068400 [exp] 42 / 5e-06 AT1G76890 387 / 1e-127 Duplicated homeodomain-like superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF10545 [flax] [poplar] MADF_DNA_bdg Alcohol dehydrogenase transcription factor Myb/SANT-like
Representative CDS sequence Show only first row Show all	>Lus10002481 pacid=23170149 polypeptide=Lus10002481 locus=Lus10002481.g ID=Lus10002481.BGIv1.0 annot-version=v1.0 ATGATAAGAGCGGAGCTGGATAGGACTTTCATGGAGACGAAAAGGAACAAGCTTCTCTGGGAAGTCATCGCTTCCAAGATGAAGGAGAAAGGCTTCCTCC GTAGCCCCGAACAGTGCAAGTGCAAATGGAAAAACCTCGTCACCCGTTACAAGCGTGATCTGCGAACAGTGAATGTTTAG
AA sequence Show only first row Show all	>Lus10002481 pacid=23170149 polypeptide=Lus10002481 locus=Lus10002481.g ID=Lus10002481.BGIv1.0 annot-version=v1.0 MIRAELDRTFMETKRNKLLWEVIASKMKEKGFLRSPEQCKCKWKNLVTRYKRDLRTVNV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38250	Trihelix		Homeodomain-like superfamily p...		Lus10002481 [exp]	0	1
AT5G13820		HPPBF-1, ATTBP1...	H-PROTEIN PROMOTE, telomeric D...		Lus10040285 [exp]	2.8	0.8204
AT1G16270			Protein kinase superfamily pro...		Lus10031749 [exp]	3.3	0.8248
AT1G18470			Transmembrane Fragile-X-F-asso...		Lus10021710 [exp]	5.5	0.8054
AT4G30080	ARF	ARF16	auxin response factor 16 (.1)		Lus10019940 [exp]	6.0	0.7980
AT1G08930		ERD6	EARLY RESPONSE TO DEHYDRATION ...		Lus10033812 [exp]	6.3	0.8016
AT2G41830			Uncharacterized protein (.1)		Lus10026298 [exp]	7.5	0.8122
AT5G03540		ATEXO70A1	exocyst subunit exo70 family p...		Lus10034151 [exp]	8.5	0.8075
AT2G30910		ARPC1B, ARPC1, ...	actin-related protein C1A (.1....		Lus10031375 [exp]	11.0	0.7955
AT1G54730			Major facilitator superfamily ...		Lus10035356 [exp]	11.2	0.8028
AT1G51590		MNS1, MANIB	ALPHA-MANNOSIDASE IB, alpha-ma...		Lus10034820 [exp]	15.3	0.8034

Compare expression of checked genes

Lus10002481 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.