Lus10002485 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G24750 117 / 1e-31 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G42220 105 / 5e-28 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT4G27700 61 / 3e-11 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G21045 56 / 7e-10 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT2G17850 42 / 6e-05 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
AT5G66170 40 / 0.0004 STR18 sulfurtransferase 18 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004811 451 / 7e-164 AT3G08920 239 / 3e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10019454 105 / 5e-27 AT4G24750 390 / 2e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10043306 103 / 1e-26 AT4G24750 389 / 3e-137 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10021032 94 / 4e-23 AT2G42220 304 / 2e-105 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10023820 92 / 2e-22 AT2G42220 302 / 1e-104 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10023243 54 / 2e-08 AT4G27700 305 / 7e-106 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10012566 52 / 2e-08 AT5G66040 129 / 1e-39 sulfurtransferase protein 16 (.1.2)
Lus10008866 46 / 7e-06 AT4G27700 249 / 4e-84 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10005635 44 / 2e-05 AT5G66040 144 / 1e-44 sulfurtransferase protein 16 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G100600 295 / 4e-102 AT3G08920 238 / 6e-80 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G086100 113 / 2e-30 AT4G24750 416 / 1e-147 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.006G059200 100 / 5e-26 AT2G42220 318 / 4e-111 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.012G020700 54 / 1e-08 AT4G27700 262 / 4e-89 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.014G131300 50 / 8e-08 AT2G21045 204 / 2e-68 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.015G008000 51 / 1e-07 AT4G27700 268 / 2e-91 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.005G111200 49 / 2e-07 AT2G17850 162 / 5e-52 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.005G106400 43 / 8e-05 AT4G35770 199 / 1e-64 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
Potri.002G014900 40 / 0.0004 AT4G35770 151 / 8e-47 SENESCENCE ASSOCIATED GENE 1, DARK INDUCIBLE 1, ARABIDOPSIS THALIANA SENESCENCE 1, Rhodanese/Cell cycle control phosphatase superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF00581 Rhodanese Rhodanese-like domain
Representative CDS sequence
>Lus10002485 pacid=23170167 polypeptide=Lus10002485 locus=Lus10002485.g ID=Lus10002485.BGIv1.0 annot-version=v1.0
ATGGCGATTCAATTGAACCGCACACTCACACCGAACTACTACTCCCACCACTACCCTTCCACCAAACAATCCAATCCTCACAAACGACAATCCCACATCG
CAGCAGCCTCGGCCGTCACCAATGGCCGGCAACTCATTCAGTCCGGCGTCGTCAAGCCCATTCTCCCCAAGGATGCAGCGAATGCTACTTCGTCGGAAGG
TTTCACTCTCTTGGATATAAGGCCGGAATGGGAGAGAAGCAAGGCTCGAGTTATAGAGTCCCTCCATGTCCCGCTCTTCGTCAACGATCCGGACACTGGC
CCTGTAACTCTTCTCAAGAAGTGGGTTCACTTCGGGTACATCGGGCTGTGGACTGGCCAGAACTTCACGACTATGAACCCAGATTTTTTAAAGCAAGTTG
AAGCTTCAGTTCCTGATAAGAACTCTAAGCTGCTTGTAGCTTGCGGCGAAGGCCTAAGGTCGATGATGGCAGCATCGAAGCTTCACCAAGGTGGGTACAA
GAATTTGGGATGGTTAGCCGGAGGATTCAACCGTGCTGACGACGGTGACTTCCAGGGCGTCGAAGGGTCTGAGAAGTTACAGTATGCTACAATTGGGGGT
GTTTCTTATTACTTTCTTCAACTGCTTATACTCTTGCAGGCTGTAGGCAAGAACAATTGA
AA sequence
>Lus10002485 pacid=23170167 polypeptide=Lus10002485 locus=Lus10002485.g ID=Lus10002485.BGIv1.0 annot-version=v1.0
MAIQLNRTLTPNYYSHHYPSTKQSNPHKRQSHIAAASAVTNGRQLIQSGVVKPILPKDAANATSSEGFTLLDIRPEWERSKARVIESLHVPLFVNDPDTG
PVTLLKKWVHFGYIGLWTGQNFTTMNPDFLKQVEASVPDKNSKLLVACGEGLRSMMAASKLHQGGYKNLGWLAGGFNRADDGDFQGVEGSEKLQYATIGG
VSYYFLQLLILLQAVGKNN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08920 Rhodanese/Cell cycle control p... Lus10002485 0 1
AT3G08920 Rhodanese/Cell cycle control p... Lus10004811 1.7 0.9728
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10038770 2.6 0.9750
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Lus10034302 3.7 0.9746
AT3G14110 FLU FLUORESCENT IN BLUE LIGHT, Tet... Lus10015677 4.5 0.9713
AT4G32320 APX6 ascorbate peroxidase 6 (.1) Lus10002916 6.0 0.9692
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Lus10041940 7.2 0.9718
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Lus10022110 7.9 0.9685
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10039092 8.9 0.9682
AT5G66470 RNA binding;GTP binding (.1) Lus10014289 9.5 0.9679
AT5G54600 Translation protein SH3-like f... Lus10038125 9.8 0.9651

Lus10002485 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.