Lus10002492 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08980 191 / 6e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G53530 100 / 2e-27 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
AT1G29960 88 / 3e-22 AGL64 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G23465 81 / 1e-19 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT2G30440 62 / 1e-11 Plsp2B, TPP plastidic type I signal peptidase 2B, thylakoid processing peptide (.1)
AT1G06870 62 / 1e-11 Plsp2A plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
AT3G24590 53 / 9e-09 PLSP1 plastidic type i signal peptidase 1 (.1)
AT1G06200 51 / 3e-08 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT2G31140 49 / 1e-07 Peptidase S24/S26A/S26B/S26C family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004822 318 / 4e-113 AT3G08980 190 / 9e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10005571 86 / 2e-21 AT1G53530 213 / 1e-71 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10013703 86 / 1e-19 AT1G78510 542 / 0.0 solanesyl diphosphate synthase 1 (.1.2)
Lus10025393 76 / 1e-17 AT1G53530 169 / 3e-54 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10032753 60 / 9e-11 AT1G06870 379 / 3e-125 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10033448 55 / 5e-10 AT1G53530 110 / 1e-32 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10023651 55 / 4e-09 AT3G24590 318 / 2e-109 plastidic type i signal peptidase 1 (.1)
Lus10034925 53 / 1e-08 AT3G24590 316 / 1e-108 plastidic type i signal peptidase 1 (.1)
Lus10011671 49 / 9e-08 AT2G30440 172 / 7e-54 plastidic type I signal peptidase 2B, thylakoid processing peptide (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G115100 229 / 4e-78 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.001G380400 99 / 1e-26 AT1G53530 227 / 3e-77 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.005G092900 94 / 2e-24 AT1G53530 189 / 5e-62 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.007G071400 86 / 2e-21 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Potri.014G036400 66 / 4e-13 AT1G06870 377 / 8e-130 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.006G157900 54 / 5e-09 AT3G24590 357 / 5e-124 plastidic type i signal peptidase 1 (.1)
Potri.002G079600 53 / 5e-09 AT3G24590 177 / 3e-55 plastidic type i signal peptidase 1 (.1)
Potri.018G081800 53 / 1e-08 AT3G24590 372 / 3e-130 plastidic type i signal peptidase 1 (.1)
Potri.002G037900 44 / 1e-05 AT1G06200 264 / 2e-90 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.005G225100 44 / 1e-05 AT2G31140 274 / 2e-94 Peptidase S24/S26A/S26B/S26C family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0299 Peptidase_SF PF00717 Peptidase_S24 Peptidase S24-like
Representative CDS sequence
>Lus10002492 pacid=23170171 polypeptide=Lus10002492 locus=Lus10002492.g ID=Lus10002492.BGIv1.0 annot-version=v1.0
ATGGCGGCTCGTGAAGTCTTGGTTAGCGCCGCGAAGAAGTTCTTTCTTTTGGGTATCATTGGAATCCCAGTTACTGACCGATTGGCCAGCGTCGTTCCAG
TACGCGGTCAATCAATGTCGCCGACACTTAACCCCGATTCCGACTCCCTTTTCGATGATCGGGTTCTGGTAGAGAAGTTGTGCCTCCGGCGGTATAGTTT
TTCTCACGGCGACGTGGTTGTTTTCCGTTCTCCATTTGATCGTAAGGAGAAACTCGTCAAGAGGATAATTGGCTTGCCTGGTGACTGGGTTGGGACTCCT
CATACGTACGATGTGGTCAAGGTTCCAGAAGGCCATTGCTGGGTTGAGGGAGACAATATGATCCCCAGCATGGATTCCAGATCATTTGGCCCGATTCCAT
TGGGTCTAGCGAGTGGAAGAGTGGTACGGATTGTATGGCCGCCTCAAAGGATGGGGAAGGTAGAACGAAAAGTACGGCAAGATAGACTGTGCCCTTCTAG
ATGA
AA sequence
>Lus10002492 pacid=23170171 polypeptide=Lus10002492 locus=Lus10002492.g ID=Lus10002492.BGIv1.0 annot-version=v1.0
MAAREVLVSAAKKFFLLGIIGIPVTDRLASVVPVRGQSMSPTLNPDSDSLFDDRVLVEKLCLRRYSFSHGDVVVFRSPFDRKEKLVKRIIGLPGDWVGTP
HTYDVVKVPEGHCWVEGDNMIPSMDSRSFGPIPLGLASGRVVRIVWPPQRMGKVERKVRQDRLCPSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08980 Peptidase S24/S26A/S26B/S26C f... Lus10002492 0 1
AT5G64680 unknown protein Lus10018951 11.4 0.7993
AT3G06778 Chaperone DnaJ-domain superfam... Lus10016835 15.8 0.7540
AT5G01470 S-adenosyl-L-methionine-depend... Lus10004816 17.9 0.7975
AT5G02740 Ribosomal protein S24e family ... Lus10015045 18.7 0.7942
AT5G63000 Mitochondrial import inner mem... Lus10027691 19.6 0.7756
AT2G39630 Nucleotide-diphospho-sugar tra... Lus10023414 24.7 0.7089
AT4G10090 ELP6 elongator protein 6 (.1) Lus10040357 35.7 0.7720
AT1G09300 Metallopeptidase M24 family pr... Lus10031427 38.9 0.7922
AT5G14600 S-adenosyl-L-methionine-depend... Lus10014554 39.1 0.7618
AT5G28840 GME "GDP-D-mannose 3',5'-epimerase... Lus10015915 40.5 0.7415

Lus10002492 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.