Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38140 71 / 1e-16 PSRP4 plastid-specific ribosomal protein 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004829 [exp] 120 / 2e-36 AT2G38140 70 / 2e-16 plastid-specific ribosomal protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G113700 [exp] 86 / 1e-22 AT2G38140 73 / 1e-17 plastid-specific ribosomal protein 4 (.1) Potri.009G124700 [exp] 41 / 1e-05 AT2G21290 45 / 1e-07 unknown protein Potri.004G163100 [exp] 40 / 4e-05 AT2G21290 41 / 6e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002497 pacid=23170159 polypeptide=Lus10002497 locus=Lus10002497.g ID=Lus10002497.BGIv1.0 annot-version=v1.0 ATGGCATCCCTGATGTTGGCAGCTCTTCCTACTGCCACTCCTCGTTCCCTCAACTTCTGTTCTCGCTTCTCCTCCTTTCGTTCGGAGTCTGGAGTCAGTC CCATCGTTGCATCATTCGATTCGCTCACCGTCTCCGCATCTTCTTCCTCCTCGTCGTCACTCCCGCTGGTGGCTTGTGGCAGAGGCGATAGGAGGACTGC CAAAGGAAAGCGGTTCAGTCATTCGTTTGGAAATGCGAGGCCTAGGAACAAGAAGAAAGGGAGAGGACCGCCGAGGATACCGGTTCCTGCCTCTCCTTTG ACTCCTGATGCTCCTTTGGATCCTAATGAATTGGTAGAGGACAGTGAAGAAGCCTCCACTGAAGAGACTGAGTGA
AA sequence Show only first row Show all	>Lus10002497 pacid=23170159 polypeptide=Lus10002497 locus=Lus10002497.g ID=Lus10002497.BGIv1.0 annot-version=v1.0 MASLMLAALPTATPRSLNFCSRFSSFRSESGVSPIVASFDSLTVSASSSSSSSLPLVACGRGDRRTAKGKRFSHSFGNARPRNKKKGRGPPRIPVPASPL TPDAPLDPNELVEDSEEASTEETE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38140		PSRP4	plastid-specific ribosomal pro...		Lus10002497 [exp]	0	1
AT2G30695			unknown protein		Lus10008364 [exp]	1.0	0.9850
AT3G63190		HFP108, AtcpRRF...	"ribosome recycling factor, ch...		Lus10042587 [exp]	3.5	0.9719
AT2G01918		PQL3	PsbQ-like 3 (.1)		Lus10004054 [exp]	4.5	0.9691
AT5G11450		PPD5	PsbP domain protein 5, Mog1/Ps...		Lus10022110 [exp]	4.6	0.9719
AT2G01755			unknown protein		Lus10030691 [exp]	5.1	0.9582
AT3G15520			Cyclophilin-like peptidyl-prol...		Lus10037891 [exp]	5.7	0.9647
AT3G56910		PSRP5	plastid-specific 50S ribosomal...		Lus10035720 [exp]	6.6	0.9599
AT1G50900		LTD, GDC1	LHCP translocation defect, Gra...		Lus10043055 [exp]	8.5	0.9682
AT1G05190		EMB2394	embryo defective 2394, Ribosom...		Lus10029120 [exp]	8.9	0.9693
AT2G42220			Rhodanese/Cell cycle control p...		Lus10023820 [exp]	9.9	0.9656

Compare expression of checked genes

Lus10002497 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.