Lus10002508 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G56670 98 / 4e-29 Ribosomal protein S30 family protein (.1)
AT4G29390 98 / 4e-29 Ribosomal protein S30 family protein (.1)
AT2G19750 98 / 4e-29 Ribosomal protein S30 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017473 122 / 1e-38 AT5G56670 98 / 4e-29 Ribosomal protein S30 family protein (.1)
Lus10028808 97 / 8e-29 AT5G56670 73 / 3e-19 Ribosomal protein S30 family protein (.1)
Lus10019054 66 / 8e-15 AT5G56670 48 / 1e-07 Ribosomal protein S30 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G086600 100 / 3e-30 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1)
Potri.015G084700 100 / 3e-30 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1)
Potri.014G147200 100 / 3e-30 AT5G56670 97 / 5e-29 Ribosomal protein S30 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04758 Ribosomal_S30 Ribosomal protein S30
Representative CDS sequence
>Lus10002508 pacid=23173045 polypeptide=Lus10002508 locus=Lus10002508.g ID=Lus10002508.BGIv1.0 annot-version=v1.0
ATGGGTAAGGTGCACGGTTCTCTTGCTCGTGCCGGTAAGGTGAGGGGACAGACTCCCAAGGTTGCAAAGCAGGAAAAGAAGAAGAGGCCACGCGGCCGTG
CTCACAAGAGAGAGCAATACAACCGCAGATTCGTCACTGCTGTTGTTGGATTCGGGAAGAAGAGAGGACCAAACTCGTCTGAGAAGTAA
AA sequence
>Lus10002508 pacid=23173045 polypeptide=Lus10002508 locus=Lus10002508.g ID=Lus10002508.BGIv1.0 annot-version=v1.0
MGKVHGSLARAGKVRGQTPKVAKQEKKKRPRGRAHKREQYNRRFVTAVVGFGKKRGPNSSEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29390 Ribosomal protein S30 family p... Lus10002508 0 1
AT5G62300 Ribosomal protein S10p/S20e fa... Lus10038910 1.0 0.9021
AT1G18800 NRP2 NAP1-related protein 2 (.1) Lus10023599 3.0 0.8432
AT1G65650 UCH2 Peptidase C12, ubiquitin carbo... Lus10042047 3.5 0.8469
AT5G16060 Cytochrome c oxidase biogenesi... Lus10033547 4.0 0.8403
AT1G14620 XTR2, EXGT-A2, ... decoy (.1.2) Lus10012875 8.1 0.8146
AT1G14620 XTR2, EXGT-A2, ... decoy (.1.2) Lus10030524 9.2 0.8216
AT2G34160 Alba DNA/RNA-binding protein (... Lus10019423 10.7 0.7742
AT5G20570 HRT1, ROC1, RBX... REGULATOR OF CULLINS-1, RING-b... Lus10008115 11.0 0.7568
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10031002 14.0 0.8074
AT5G16950 unknown protein Lus10026852 16.7 0.7619

Lus10002508 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.