Lus10002511 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30440 169 / 7e-52 GAE1 UDP-D-glucuronate 4-epimerase 1 (.1)
AT4G00110 162 / 7e-49 GAE3 UDP-D-glucuronate 4-epimerase 3 (.1)
AT2G45310 162 / 7e-49 GAE4 UDP-D-glucuronate 4-epimerase 4 (.1)
AT1G02000 160 / 4e-48 GAE2 UDP-D-glucuronate 4-epimerase 2 (.1)
AT4G12250 149 / 4e-44 GAE5 UDP-D-glucuronate 4-epimerase 5 (.1)
AT3G23820 147 / 7e-43 GAE6 UDP-D-glucuronate 4-epimerase 6 (.1)
AT1G78570 39 / 0.0008 ATRHM1, RHM1, ROL1 REPRESSOR OF LRX1 1, ARABIDOPSIS THALIANA RHAMNOSE BIOSYNTHESIS 1, rhamnose biosynthesis 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008893 195 / 1e-61 AT4G30440 767 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Lus10019967 175 / 4e-54 AT4G30440 688 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Lus10015496 175 / 5e-54 AT4G30440 764 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Lus10032391 159 / 8e-48 AT1G02000 620 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Lus10009288 159 / 1e-47 AT4G00110 704 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10000787 158 / 3e-47 AT4G00110 731 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10030281 158 / 3e-47 AT4G00110 753 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10015876 158 / 4e-47 AT4G00110 751 / 0.0 UDP-D-glucuronate 4-epimerase 3 (.1)
Lus10016640 149 / 8e-44 AT3G23820 746 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G146500 156 / 1e-46 AT1G02000 724 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.014G068400 155 / 2e-46 AT1G02000 714 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.003G114600 155 / 2e-46 AT4G12250 587 / 0.0 UDP-D-glucuronate 4-epimerase 5 (.1)
Potri.012G128200 155 / 2e-46 AT1G02000 544 / 0.0 UDP-D-glucuronate 4-epimerase 2 (.1)
Potri.018G100400 154 / 5e-46 AT4G30440 771 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Potri.006G178500 151 / 6e-45 AT4G30440 757 / 0.0 UDP-D-glucuronate 4-epimerase 1 (.1)
Potri.001G320000 147 / 3e-43 AT3G23820 714 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Potri.017G059100 145 / 4e-42 AT3G23820 724 / 0.0 UDP-D-glucuronate 4-epimerase 6 (.1)
Potri.001G383500 39 / 0.0007 AT1G78570 1190 / 0.0 REPRESSOR OF LRX1 1, ARABIDOPSIS THALIANA RHAMNOSE BIOSYNTHESIS 1, rhamnose biosynthesis 1 (.1)
Potri.011G103700 38 / 0.001 AT1G78570 1211 / 0.0 REPRESSOR OF LRX1 1, ARABIDOPSIS THALIANA RHAMNOSE BIOSYNTHESIS 1, rhamnose biosynthesis 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF01370 Epimerase NAD dependent epimerase/dehydratase family
Representative CDS sequence
>Lus10002511 pacid=23166287 polypeptide=Lus10002511 locus=Lus10002511.g ID=Lus10002511.BGIv1.0 annot-version=v1.0
ATGCTCGAGAGCCACGAGATCTACGTTGTCGCCGGAGACGTCAACGACGGGAAGCTATTGTCAAAGCTCTTCCGTGTTGTAGCATTCACTCACGTGATGT
ATCTCGCAACTCAGACAGGAGTCTGTTACGCGATGGAGAATTTGAATTCATATGCCCATTCAAATATTACAGGTTTAGGTACGCTCCTCGAGATCTGCAA
GTCAGCAGATCCACAACCAGCGGTCCTCAGGTCTTCTTCAAGCTACGTCCCCGAATTAAATGACAAAGCTTCGTTCTCTGAGTCCGATCAAACCGATCAA
CCGGCGGGTCTCTATGTTGCGACGAAGAAATCCGAAGAAAAAATCACTCACACTTACAATCACAGTGAGGTTGAGGAAGAACTTGGTGCCGAACGCCATT
GTGGACGAGGAAGAAGAAAGAGATAA
AA sequence
>Lus10002511 pacid=23166287 polypeptide=Lus10002511 locus=Lus10002511.g ID=Lus10002511.BGIv1.0 annot-version=v1.0
MLESHEIYVVAGDVNDGKLLSKLFRVVAFTHVMYLATQTGVCYAMENLNSYAHSNITGLGTLLEICKSADPQPAVLRSSSSYVPELNDKASFSESDQTDQ
PAGLYVATKKSEEKITHTYNHSEVEEELGAERHCGRGRRKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10002511 0 1
AT1G24590 AP2_ERF ESR2, DRNL, SOB... FOR SUPPRESSOR OF PHYTOCHROMEB... Lus10017907 1.0 0.8966
AT1G28030 2-oxoglutarate (2OG) and Fe(II... Lus10037429 3.5 0.8049
AT3G59510 Leucine-rich repeat (LRR) fami... Lus10027040 5.0 0.8052
AT5G28237 Pyridoxal-5'-phosphate-depende... Lus10008278 6.0 0.7908
Lus10035468 11.8 0.7526
AT4G28050 TET7 tetraspanin7 (.1) Lus10038964 15.1 0.8244
AT5G63800 MUM2, BGAL6 MUCILAGE-MODIFIED 2, beta-gala... Lus10033500 15.2 0.7865
Lus10023556 15.4 0.7994
AT4G30030 Eukaryotic aspartyl protease f... Lus10007053 15.6 0.7684
AT4G34770 SAUR-like auxin-responsive pro... Lus10012181 16.7 0.7223

Lus10002511 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.