Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40500 134 / 5e-42 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022273 [exp] 202 / 6e-69 AT5G40500 155 / 2e-50 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G344700 [exp] 163 / 1e-53 AT5G40500 140 / 1e-44 unknown protein Potri.017G071300 [exp] 163 / 2e-53 AT5G40500 139 / 6e-44 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002519 pacid=23146201 polypeptide=Lus10002519 locus=Lus10002519.g ID=Lus10002519.BGIv1.0 annot-version=v1.0 ATGGCGATGGCGTCGTGGAGCCATTCCAGTGCCTATAAGAAGGCTCCGTCTCTGCGAATTTTGTGCAGAAAGAAAGAAAGAGATCATCATATTCTTCCTT ACAAAGTCATTGAGATCACTCCGCCTCCTAAGAACCTCGGCATCCGTTGCCTTCCTCCCAACTTGCAATGTGGGGAGAGCGTGACAATTGAAGGCCAAGC GTATACAGTGTCAGCGGTAACTCATCGATACCAACTCCGGAAAGGGAAGTATGAACCGAGTGAGAAGAGGCTTGATGTTCTGTCCACAGGGAGATACATG TTGAACTTATATTTGGAGAACTTGCTAGAACAATCCTGA
AA sequence Show only first row Show all	>Lus10002519 pacid=23146201 polypeptide=Lus10002519 locus=Lus10002519.g ID=Lus10002519.BGIv1.0 annot-version=v1.0 MAMASWSHSSAYKKAPSLRILCRKKERDHHILPYKVIEITPPPKNLGIRCLPPNLQCGESVTIEGQAYTVSAVTHRYQLRKGKYEPSEKRLDVLSTGRYM LNLYLENLLEQS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40500			unknown protein		Lus10002519 [exp]	0	1
AT2G05620		PGR5	proton gradient regulation 5 (...		Lus10023734 [exp]	6.5	0.9005
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10017476 [exp]	7.8	0.9062
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10015831 [exp]	9.5	0.8968
					Lus10025227 [exp]	13.6	0.8355
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10020418 [exp]	15.5	0.8884
AT3G54890		LHCA1	photosystem I light harvesting...		Lus10040391 [exp]	15.9	0.8849
AT5G19940			Plastid-lipid associated prote...		Lus10042448 [exp]	17.9	0.8787
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10028806 [exp]	18.4	0.8952
AT2G30570		PSBW	photosystem II reaction center...		Lus10024858 [exp]	19.0	0.8954
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10020415 [exp]	20.5	0.8832

Compare expression of checked genes

Lus10002519 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.