Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23180 106 / 4e-28 CYP96A1 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) AT4G39480 105 / 6e-28 CYP96A9 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) AT4G39490 103 / 2e-27 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) AT1G57750 103 / 3e-27 MAH1, CYP96A15 MID-CHAIN ALKANE HYDROXYLASE 1, "cytochrome P450, family 96, subfamily A, polypeptide 15", cytochrome P450, family 96, subfamily A, polypeptide 15 (.1.2) AT2G21910 98 / 4e-25 CYP96A5 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) AT1G47620 96 / 2e-24 CYP96A8 "cytochrome P450, family 96, subfamily A, polypeptide 8", cytochrome P450, family 96, subfamily A, polypeptide 8 (.1) AT4G39500 95 / 4e-24 CYP96A11 "cytochrome P450, family 96, subfamily A, polypeptide 11", cytochrome P450, family 96, subfamily A, polypeptide 11 (.1) AT5G58860 93 / 2e-23 CYP86A1 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) AT1G65340 93 / 2e-23 CYP96A3 "cytochrome P450, family 96, subfamily A, polypeptide 3", cytochrome P450, family 96, subfamily A, polypeptide 3 (.1) AT4G32170 92 / 5e-23 CYP96A2 "cytochrome P450, family 96, subfamily A, polypeptide 2", cytochrome P450, family 96, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002525 [exp] 168 / 3e-51 AT4G39490 410 / 2e-138 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10022277 [exp] 167 / 6e-51 AT4G39490 395 / 1e-132 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10018161 [exp] 122 / 1e-36 AT4G39480 204 / 5e-64 "cytochrome P450, family 96, subfamily A, polypeptide 9", cytochrome P450, family 96, subfamily A, polypeptide 9 (.1) Lus10025677 [exp] 124 / 7e-35 AT2G23180 361 / 1e-119 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10028047 [exp] 122 / 4e-34 AT2G21910 375 / 1e-125 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) Lus10003756 [exp] 117 / 6e-34 AT2G23180 219 / 1e-68 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10025678 [exp] 118 / 1e-32 AT4G39490 363 / 9e-121 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10015306 [exp] 117 / 7e-32 AT4G39490 342 / 3e-108 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10015307 [exp] 106 / 5e-30 AT2G23180 219 / 6e-69 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G397900 [exp] 119 / 1e-32 AT4G39490 480 / 6e-166 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.007G080300 [exp] 112 / 4e-30 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G132800 [exp] 111 / 4e-30 AT4G39490 589 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G086900 [exp] 110 / 1e-29 AT2G23180 455 / 2e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.005G064400 [exp] 110 / 2e-29 AT4G39490 477 / 8e-165 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.003G129100 [exp] 98 / 5e-25 AT1G63710 823 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Potri.014G085800 [exp] 97 / 9e-25 AT2G45970 866 / 0.0 LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) Potri.008G125300 [exp] 96 / 3e-24 AT4G39490 410 / 4e-139 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.009G043700 [exp] 94 / 9e-24 AT5G58860 827 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 1", cytochrome P450, family 86, subfamily A, polypeptide 1 (.1) Potri.005G094500 [exp] 93 / 3e-23 AT1G47620 372 / 7e-124 "cytochrome P450, family 96, subfamily A, polypeptide 8", cytochrome P450, family 96, subfamily A, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10002523 pacid=23146200 polypeptide=Lus10002523 locus=Lus10002523.g ID=Lus10002523.BGIv1.0 annot-version=v1.0 ATGGGGAGGATGGAAGAGATGTGGGGGAAAGATTGCATGGAGTTCAAGCCTGAGAGATGGATTTTGGAGAAGGGAGCGATAATACATGTGCCGTCTTACA AGTTCATGACGTTTCTGGCCGGTGCAAGGACTTGTTTGGGCAAGAACATGGCTTTCATGGAAGTGAAGGCTTTGGCTAGTGCACTTCTCTATAACTACAG GTTTCATCTGGTGGAGGATGATCATCATCAAGGGCATCGACGTCAAATTACTTCGATGGTAATCACCATTAAAGATGGATTGAAGACTAGGGTTTCCAAG AGGGATCATCACCATCTATAA
AA sequence Show only first row Show all	>Lus10002523 pacid=23146200 polypeptide=Lus10002523 locus=Lus10002523.g ID=Lus10002523.BGIv1.0 annot-version=v1.0 MGRMEEMWGKDCMEFKPERWILEKGAIIHVPSYKFMTFLAGARTCLGKNMAFMEVKALASALLYNYRFHLVEDDHHQGHRRQITSMVITIKDGLKTRVSK RDHHHL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G57750		MAH1, CYP96A15	MID-CHAIN ALKANE HYDROXYLASE 1...		Lus10002523 [exp]	0	1
AT3G51870			Mitochondrial substrate carrie...		Lus10027789 [exp]	1.7	0.9512
AT2G21910		CYP96A5	"cytochrome P450, family 96, s...		Lus10002524 [exp]	2.0	0.9307
AT4G12970		EPFL9, STOMAGEN	stomagen (.1)		Lus10009589 [exp]	4.6	0.8954
AT3G23530			Cyclopropane-fatty-acyl-phosph...		Lus10011784 [exp]	4.9	0.8820
AT3G51870			Mitochondrial substrate carrie...		Lus10035509 [exp]	7.3	0.9207
AT2G31980		AtCYS2	PHYTOCYSTATIN 2 (.1)		Lus10041257 [exp]	12.0	0.8509
AT3G62030		CYP20-3, ROC4	cyclophilin 20-3, rotamase CYP...		Lus10038015 [exp]	13.1	0.8914
AT5G23690			Polynucleotide adenylyltransfe...		Lus10016719 [exp]	13.4	0.8854
AT3G12080		EMB2738	embryo defective 2738, GTP-bin...		Lus10027371 [exp]	15.6	0.9010
AT3G21300			RNA methyltransferase family p...		Lus10009743 [exp]	16.9	0.8754

Compare expression of checked genes

Lus10002523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.