Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23180 91 / 4e-22 CYP96A1 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) AT1G65340 91 / 4e-22 CYP96A3 "cytochrome P450, family 96, subfamily A, polypeptide 3", cytochrome P450, family 96, subfamily A, polypeptide 3 (.1) AT1G57750 91 / 5e-22 MAH1, CYP96A15 MID-CHAIN ALKANE HYDROXYLASE 1, "cytochrome P450, family 96, subfamily A, polypeptide 15", cytochrome P450, family 96, subfamily A, polypeptide 15 (.1.2) AT2G21910 91 / 6e-22 CYP96A5 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) AT4G39490 87 / 1e-20 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) AT4G39510 83 / 2e-19 CYP96A12 "cytochrome P450, family 96, subfamily A, polypeptide 12", cytochrome P450, family 96, subfamily A, polypeptide 12 (.1) AT5G52320 83 / 3e-19 CYP96A4 "cytochrome P450, family 96, subfamily A, polypeptide 4", cytochrome P450, family 96, subfamily A, polypeptide 4 (.1) AT4G32170 81 / 1e-18 CYP96A2 "cytochrome P450, family 96, subfamily A, polypeptide 2", cytochrome P450, family 96, subfamily A, polypeptide 2 (.1) AT1G47620 79 / 5e-18 CYP96A8 "cytochrome P450, family 96, subfamily A, polypeptide 8", cytochrome P450, family 96, subfamily A, polypeptide 8 (.1) AT5G02900 77 / 3e-17 CYP96A13 "cytochrome P450, family 96, subfamily A, polypeptide 13", cytochrome P450, family 96, subfamily A, polypeptide 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002525 [exp] 214 / 4e-68 AT4G39490 410 / 2e-138 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10022277 [exp] 197 / 1e-61 AT4G39490 395 / 1e-132 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10022279 [exp] 129 / 7e-36 AT2G23180 449 / 4e-154 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10002527 [exp] 125 / 2e-34 AT2G23180 454 / 7e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10003669 [exp] 124 / 5e-34 AT2G23180 440 / 4e-150 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10035234 [exp] 107 / 6e-28 AT4G39490 382 / 1e-127 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10035235 [exp] 94 / 3e-23 AT4G39490 359 / 2e-118 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10018162 [exp] 81 / 3e-19 AT4G39490 113 / 7e-29 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10010193 [exp] 76 / 9e-17 AT5G23190 741 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G087000 [exp] 114 / 1e-30 AT2G23180 373 / 2e-125 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.015G086900 [exp] 110 / 3e-29 AT2G23180 455 / 2e-156 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Potri.001G397900 [exp] 108 / 2e-28 AT4G39490 480 / 6e-166 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.005G064400 [exp] 105 / 3e-27 AT4G39490 477 / 8e-165 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.015G132800 [exp] 90 / 7e-22 AT4G39490 589 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.007G080300 [exp] 82 / 4e-19 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.008G125300 [exp] 80 / 2e-18 AT4G39490 410 / 4e-139 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.003G129100 [exp] 70 / 1e-14 AT1G63710 823 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1) Potri.007G072100 [exp] 68 / 5e-14 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.005G092200 [exp] 67 / 6e-14 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002524 pacid=23146205 polypeptide=Lus10002524 locus=Lus10002524.g ID=Lus10002524.BGIv1.0 annot-version=v1.0 ATGAAATCGCCCGTCTATGATTGGCCATTGTTGAGGATGCTTCCTAGTCTCCTTTGGAACAAATCAAACCTCAACGATTTCTTCGCCCAAGCACTCAGAC GAACTGGCGGAACCTTCTTGCTCAAGGGTCCGTCTTTCATCACTGCCGACTACATCGTCACAAGTGATGCCATGAACTGCCACCACATCTTCAGCCGCAA CTCGGCCAACTACGACAAGTGCCAAGACTTCAAGCTCATAATGGAGGCTCTCGGAGAAGGAATCTTCAACGTCGATGGAGATTCATGGAAGTACCGAAGA CAGCTCTTGCATTCCCTCCTGAACAACTACGCGTTGGAGTCCCGCATGAAGAGGACCCTCGCGTGCACGCTGTTCCGAGTCTTGGATGATGCATCCATGC TCGGAACGTTGGTCGACATGTAG
AA sequence Show only first row Show all	>Lus10002524 pacid=23146205 polypeptide=Lus10002524 locus=Lus10002524.g ID=Lus10002524.BGIv1.0 annot-version=v1.0 MKSPVYDWPLLRMLPSLLWNKSNLNDFFAQALRRTGGTFLLKGPSFITADYIVTSDAMNCHHIFSRNSANYDKCQDFKLIMEALGEGIFNVDGDSWKYRR QLLHSLLNNYALESRMKRTLACTLFRVLDDASMLGTLVDM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21910		CYP96A5	"cytochrome P450, family 96, s...		Lus10002524 [exp]	0	1
AT5G53210	bHLH	SPCH, bHLH098	SPEECHLESS, basic helix-loop-h...		Lus10039328 [exp]	1.0	0.9405
AT5G60880		BASL	breaking of asymmetry in the s...		Lus10034654 [exp]	1.7	0.9179
AT1G57750		MAH1, CYP96A15	MID-CHAIN ALKANE HYDROXYLASE 1...		Lus10002523 [exp]	2.0	0.9307
AT2G31980		AtCYS2	PHYTOCYSTATIN 2 (.1)		Lus10041257 [exp]	2.2	0.9082
AT1G80080		AtRLP17, TMM	TOO MANY MOUTHS, Receptor Like...		Lus10026208 [exp]	6.0	0.8740
AT1G80080		AtRLP17, TMM	TOO MANY MOUTHS, Receptor Like...		Lus10042458 [exp]	9.4	0.8793
AT1G68890			magnesium ion binding;thiamin ...		Lus10030915 [exp]	12.2	0.9109
AT2G37220			RNA-binding (RRM/RBD/RNP motif...		Lus10026514 [exp]	14.7	0.8947
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Lus10002587 [exp]	15.9	0.8482
AT1G06950		ATTIC110, TIC11...	ARABIDOPSIS THALIANA TRANSLOCO...		Lus10042231 [exp]	17.3	0.8952

Compare expression of checked genes

Lus10002524 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.