Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G08250 57 / 3e-10 Cytochrome P450 superfamily protein (.1) AT3G26125 57 / 3e-10 CYP86C2 "cytochrome P450, family 86, subfamily C, polypeptide 2", cytochrome P450, family 86, subfamily C, polypeptide 2 (.1) AT5G23190 56 / 4e-10 CYP86B1 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) AT1G34540 55 / 2e-09 CYP94D1 "cytochrome P450, family 94, subfamily D, polypeptide 1", cytochrome P450, family 94, subfamily D, polypeptide 1 (.1) AT3G56630 54 / 4e-09 CYP94D2 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) AT2G27690 54 / 4e-09 CYP94C1 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1) AT1G47620 53 / 7e-09 CYP96A8 "cytochrome P450, family 96, subfamily A, polypeptide 8", cytochrome P450, family 96, subfamily A, polypeptide 8 (.1) AT5G02900 51 / 3e-08 CYP96A13 "cytochrome P450, family 96, subfamily A, polypeptide 13", cytochrome P450, family 96, subfamily A, polypeptide 13 (.1) AT4G39490 51 / 4e-08 CYP96A10 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) AT1G01600 50 / 5e-08 CYP86A4 "cytochrome P450, family 86, subfamily A, polypeptide 4", cytochrome P450, family 86, subfamily A, polypeptide 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022277 [exp] 66 / 3e-13 AT4G39490 395 / 1e-132 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10002525 [exp] 65 / 6e-13 AT4G39490 410 / 2e-138 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10037157 [exp] 61 / 2e-11 AT1G69500 868 / 0.0 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) Lus10036772 [exp] 59 / 4e-11 AT1G69500 863 / 0.0 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) Lus10025678 [exp] 59 / 6e-11 AT4G39490 363 / 9e-121 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Lus10025677 [exp] 59 / 8e-11 AT2G23180 361 / 1e-119 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10028047 [exp] 58 / 1e-10 AT2G21910 375 / 1e-125 "cytochrome P450, family 96, subfamily A, polypeptide 5", cytochrome P450, family 96, subfamily A, polypeptide 5 (.1) Lus10018160 [exp] 57 / 1e-10 AT2G23180 127 / 4e-45 "cytochrome P450, family 96, subfamily A, polypeptide 1", cytochrome P450, family 96, subfamily A, polypeptide 1 (.1) Lus10043378 [exp] 57 / 3e-10 AT2G27690 341 / 1e-115 "cytochrome P450, family 94, subfamily C, polypeptide 1", cytochrome P450, family 94, subfamily C, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G331100 [exp] 57 / 3e-10 AT3G01900 597 / 0.0 "cytochrome P450, family 94, subfamily B, polypeptide 2", cytochrome P450, family 94, subfamily B, polypeptide 2 (.1) Potri.007G072100 [exp] 57 / 3e-10 AT5G23190 799 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.010G050100 [exp] 56 / 5e-10 AT1G24540 684 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.005G092200 [exp] 55 / 1e-09 AT5G23190 788 / 0.0 "cytochrome P450, family 86, subfamily B, polypeptide 1", cytochrome P450, family 86, subfamily B, polypeptide 1 (.1) Potri.008G088900 [exp] 54 / 2e-09 AT1G69500 868 / 0.0 "cytochrome P450, family 704, subfamily B, polypeptide 1", cytochrome P450, family 704, subfamily B, polypeptide 1 (.1) Potri.012G096800 [exp] 54 / 3e-09 AT3G48520 611 / 0.0 cytochrome P450, family 94, subfamily B, polypeptide 3 (.1) Potri.008G183300 [exp] 53 / 8e-09 AT1G24540 682 / 0.0 "cytochrome P450, family 86, subfamily C, polypeptide 1", cytochrome P450, family 86, subfamily C, polypeptide 1 (.1) Potri.007G080300 [exp] 52 / 9e-09 AT4G39490 574 / 0.0 "cytochrome P450, family 96, subfamily A, polypeptide 10", cytochrome P450, family 96, subfamily A, polypeptide 10 (.1) Potri.006G033600 [exp] 50 / 7e-08 AT3G56630 576 / 0.0 "cytochrome P450, family 94, subfamily D, polypeptide 2", cytochrome P450, family 94, subfamily D, polypeptide 2 (.1) Potri.012G131200 [exp] 48 / 4e-07 AT2G44890 511 / 7e-178 "cytochrome P450, family 704, subfamily A, polypeptide 1", cytochrome P450, family 704, subfamily A, polypeptide 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10002526 pacid=23146209 polypeptide=Lus10002526 locus=Lus10002526.g ID=Lus10002526.BGIv1.0 annot-version=v1.0 ATGACGACAACCCGGTTTGCAAACAACAATAATGCAGGTAAAACAAGAAGTAAAAAGACCCACCACAAGCATGACTTGTTGACACAATTAATCTTGTTAG GGAAAGGAGACGATCATAAAAAATTATCAGACAAGTGTTTGAGAGACACTACCTTAACCTTCGTAGCTGCAGGGAGGAATTCCATATCCGTAGATCTCAC ATGGCTTCTATGGGTACTCGCGAGACACCCGGAGATTGAGAAAAAAAATAGACAATGTGCTCGAAATAATCATCCATTTCGTGCGGTGGATGATAGTGAT GTTATTAGGTCGGTTCCTTCTCTGGTGCTGGTAATGAAGAATGGCTTCAAGACTAGAGTTTCGAACAGGGATCCCTCTGAACCGATGGAAGTGCATGATT AA
AA sequence Show only first row Show all	>Lus10002526 pacid=23146209 polypeptide=Lus10002526 locus=Lus10002526.g ID=Lus10002526.BGIv1.0 annot-version=v1.0 MTTTRFANNNNAGKTRSKKTHHKHDLLTQLILLGKGDDHKKLSDKCLRDTTLTFVAAGRNSISVDLTWLLWVLARHPEIEKKNRQCARNNHPFRAVDDSD VIRSVPSLVLVMKNGFKTRVSNRDPSEPMEVHD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27690		CYP94C1	"cytochrome P450, family 94, s...		Lus10002526 [exp]	0	1
AT5G61190	C2H2ZnF		putative endonuclease or glyco...		Lus10003476 [exp]	1.7	0.9388
AT1G23000			Heavy metal transport/detoxifi...		Lus10032445 [exp]	4.7	0.9343
AT1G62760			Plant invertase/pectin methyle...		Lus10031132 [exp]	5.9	0.8908
AT5G49170			unknown protein		Lus10024954 [exp]	6.3	0.8958
AT1G44130			Eukaryotic aspartyl protease f...		Lus10018148 [exp]	12.6	0.8622
AT2G24440			selenium binding (.1)		Lus10026958 [exp]	15.3	0.9192
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Lus10034690 [exp]	16.1	0.8847
AT3G15790		MBD11, ATMBD11	methyl-CPG-binding domain 11 (...		Lus10030108 [exp]	16.1	0.8791
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10039303 [exp]	20.3	0.8705
AT5G47500		PME5	pectin methylesterase 5, Pecti...		Lus10004720 [exp]	20.5	0.8808

Compare expression of checked genes

Lus10002526 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.