Lus10002528 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G46960 70 / 2e-14 RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
AT1G59760 45 / 6e-06 AtMTR4 homolog of yeast MTR4, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
AT2G06990 39 / 0.0006 HEN2 hua enhancer 2, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017528 72 / 2e-15 AT3G46960 1971 / 0.0 RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Lus10001185 59 / 3e-12 AT5G17430 57 / 2e-10 BABY BOOM, Integrase-type DNA-binding superfamily protein (.1)
Lus10036719 42 / 5e-05 AT3G54320 288 / 3e-93 WRINKLED 1, WRINKLED, ACTIVATOR OF SPO\(MIN\)::LUC1, Integrase-type DNA-binding superfamily protein (.1.2.3)
Lus10024454 42 / 5e-05 AT1G59760 1557 / 0.0 homolog of yeast MTR4, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Lus10007442 42 / 6e-05 AT1G59760 1523 / 0.0 homolog of yeast MTR4, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Lus10037209 42 / 6e-05 AT3G54320 286 / 1e-92 WRINKLED 1, WRINKLED, ACTIVATOR OF SPO\(MIN\)::LUC1, Integrase-type DNA-binding superfamily protein (.1.2.3)
Lus10013268 39 / 0.0006 AT3G54320 275 / 3e-90 WRINKLED 1, WRINKLED, ACTIVATOR OF SPO\(MIN\)::LUC1, Integrase-type DNA-binding superfamily protein (.1.2.3)
Lus10022944 39 / 0.0007 AT2G06990 713 / 0.0 hua enhancer 2, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Lus10027599 39 / 0.0008 AT2G06990 1633 / 0.0 hua enhancer 2, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G041200 69 / 2e-14 AT3G46960 1988 / 0.0 RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Potri.010G092800 44 / 1e-05 AT3G54320 259 / 2e-82 WRINKLED 1, WRINKLED, ACTIVATOR OF SPO\(MIN\)::LUC1, Integrase-type DNA-binding superfamily protein (.1.2.3)
Potri.017G078600 44 / 1e-05 AT3G54320 289 / 2e-94 WRINKLED 1, WRINKLED, ACTIVATOR OF SPO\(MIN\)::LUC1, Integrase-type DNA-binding superfamily protein (.1.2.3)
Potri.004G228700 42 / 4e-05 AT1G59760 1581 / 0.0 homolog of yeast MTR4, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Potri.018G146001 40 / 0.0002 AT2G06990 972 / 0.0 hua enhancer 2, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
Potri.006G078000 40 / 0.0002 AT2G06990 1634 / 0.0 hua enhancer 2, RNA helicase, ATP-dependent, SK12/DOB1 protein (.1)
PFAM info
Representative CDS sequence
>Lus10002528 pacid=23157292 polypeptide=Lus10002528 locus=Lus10002528.g ID=Lus10002528.BGIv1.0 annot-version=v1.0
ATGTATGAGATTGACGTCGATGAAGACCACATGGACGAGCTTGGATCCCAGCCATTCGATGCTAATGGGATGCTTCTTAACGGGCTTATGAATACAAAAG
AGGTAGCGGCAAGGGCTTATGATTTAGCTCAAGTCCTGGGGAACTTCAACTTTGACCAACTTCCAGATTATGAGGAGGTTGAGATCATGAAACATGTAAC
TAGAGAAGATTACTTACTTCGCTTCCTTAAGAAGTTCGTTGATATTGATGCTGCTTTTGAAGAACATTTGTCAGGAGACGAACCTTCACTCTCTGATGTC
GAAGTGAAGCACTGCACCAAGGCTGTCTGCACTGCTCCCATGAAAACGATCAGTAATCAAAAGTACCGCGATTTCTGTGAGAAGCTTGATGTTGGCCTTC
AGACTGGTGATATTAGACTGGTCTTATCATGA
AA sequence
>Lus10002528 pacid=23157292 polypeptide=Lus10002528 locus=Lus10002528.g ID=Lus10002528.BGIv1.0 annot-version=v1.0
MYEIDVDEDHMDELGSQPFDANGMLLNGLMNTKEVAARAYDLAQVLGNFNFDQLPDYEEVEIMKHVTREDYLLRFLKKFVDIDAAFEEHLSGDEPSLSDV
EVKHCTKAVCTAPMKTISNQKYRDFCEKLDVGLQTGDIRLVLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G46960 RNA helicase, ATP-dependent, S... Lus10002528 0 1
AT5G61140 U5 small nuclear ribonucleopro... Lus10040524 2.2 0.9271
AT3G19190 ATATG2 autophagy 2 (.1) Lus10014045 4.2 0.8912
AT3G05090 LRS1 LATERAL ROOT STIMULATOR 1, Tra... Lus10001717 6.3 0.9017
AT3G14460 LRR and NB-ARC domains-contain... Lus10024173 6.3 0.8686
AT3G14010 CID4 CTC-interacting domain 4 (.1.2... Lus10015638 9.5 0.8778
AT5G15020 SNL2 SIN3-like 2 (.1.2) Lus10032181 10.4 0.8831
AT3G02065 P-loop containing nucleoside t... Lus10006736 12.0 0.7707
AT3G19190 ATATG2 autophagy 2 (.1) Lus10019868 12.6 0.8820
AT3G13225 WW domain-containing protein (... Lus10005845 14.4 0.8747
AT1G08600 ATRX, CHR20 P-loop containing nucleoside t... Lus10003572 14.7 0.8756

Lus10002528 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.