Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19530 44 / 2e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G228600 [exp] 71 / 1e-16 AT1G19530 81 / 2e-20 unknown protein Potri.002G034500 [exp] 49 / 2e-08 AT1G19530 62 / 4e-13 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002540 pacid=23157303 polypeptide=Lus10002540 locus=Lus10002540.g ID=Lus10002540.BGIv1.0 annot-version=v1.0 ATGAAGAAGAAAATCCACGAGGACCATCTCCAGGCTGTTTCTCCCGGCAGTTCACAGGATGGTGGATCGTCGACGATGTCATGGATAAAGGATCATCAGG TGGAAGGTGGGACGTTGCCGTTAAGATCTAGGTCGCTGCCGTCGGTGGTTGGGTCGTCGGTATTGGAAGAGGAGAGGGAGAATTTGGAGAAGTTAATGAT GAAGAAGAAGGAGGAATTAGCAGCAGCAGGGTGGTGGAGGAGGAGCAACTGGGCGTTCTTGAATGAGCCACCGGTGATGGAAAAAGCTTCCAACAGTTAC GCTGCTCAGTACCATATCGCCACCGCCAACTAG
AA sequence Show only first row Show all	>Lus10002540 pacid=23157303 polypeptide=Lus10002540 locus=Lus10002540.g ID=Lus10002540.BGIv1.0 annot-version=v1.0 MKKKIHEDHLQAVSPGSSQDGGSSTMSWIKDHQVEGGTLPLRSRSLPSVVGSSVLEEERENLEKLMMKKKEELAAAGWWRRSNWAFLNEPPVMEKASNSY AAQYHIATAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G19530			unknown protein		Lus10002540 [exp]	0	1
AT5G57655			xylose isomerase family protei...		Lus10001321 [exp]	1.7	0.9795
AT1G18270			ketose-bisphosphate aldolase c...		Lus10008754 [exp]	2.0	0.9794
AT4G34030		MCCB	3-methylcrotonyl-CoA carboxyla...		Lus10014068 [exp]	2.4	0.9764
AT2G37380		MAKR3	MEMBRANE-ASSOCIATED KINASE REG...		Lus10025286 [exp]	2.8	0.9692
AT5G24890			unknown protein		Lus10009793 [exp]	3.2	0.9730
AT1G08630		THA1	threonine aldolase 1 (.1.2.3.4...		Lus10014658 [exp]	3.5	0.9759
AT3G06860		ATMFP2, ATMPF2,...	multifunctional protein 2 (.1)		Lus10006502 [exp]	6.0	0.9614
AT4G33150		LKR/SDH, SDH	lysine-ketoglutarate reductase...		Lus10009808 [exp]	6.5	0.9704
AT4G15630			Uncharacterised protein family...		Lus10033971 [exp]	9.1	0.9362
AT2G46150			Late embryogenesis abundant (L...		Lus10007904 [exp]	9.6	0.9324

Compare expression of checked genes

Lus10002540 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.