Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G08820 91 / 3e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G20230 89 / 2e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G08070 87 / 7e-22 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G40410 86 / 2e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G24000 84 / 9e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G44230 84 / 1e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G18750 84 / 1e-20 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G22690 83 / 2e-20 unknown protein AT1G09410 81 / 1e-19 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G29230 81 / 2e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027365 [exp] 145 / 1e-46 AT4G02750 133 / 3e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000117 [exp] 85 / 5e-21 AT4G21065 404 / 5e-139 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10029436 [exp] 85 / 6e-21 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039388 [exp] 85 / 7e-21 AT5G43790 506 / 8e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10016387 [exp] 84 / 1e-20 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10019735 [exp] 84 / 1e-20 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000213 [exp] 84 / 2e-20 AT2G13600 435 / 8e-144 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10006628 [exp] 83 / 3e-20 AT4G21065 399 / 7e-137 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10015225 [exp] 83 / 3e-20 AT4G18750 990 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G258500 [exp] 118 / 1e-32 AT2G40720 481 / 4e-157 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G245300 [exp] 89 / 1e-22 AT3G22690 570 / 0.0 unknown protein Potri.006G105700 [exp] 89 / 3e-22 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G021300 [exp] 87 / 1e-21 AT1G20230 852 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G051300 [exp] 86 / 2e-21 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G059400 [exp] 86 / 2e-21 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G119000 [exp] 85 / 7e-21 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G128900 [exp] 84 / 8e-21 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G012600 [exp] 84 / 9e-21 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G096400 [exp] 84 / 1e-20 AT5G03800 993 / 0.0 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002561 pacid=23165490 polypeptide=Lus10002561 locus=Lus10002561.g ID=Lus10002561.BGIv1.0 annot-version=v1.0 ATGCCTGTGGAACCTGATGCGTCCATTTGGAGAGCTCTGTTGAACGGGTGCAGAGTGGGTTCTGACACGGAAATGGCTGGATCGGTGTTTCGGAATCTGG TTCGGTTGGAACCGATGAATCCTGGGAACTATGTCTTGCTGGCGAACATCTATGCAGCAGCAGGGCTTTGGTCTGATGTTAGGCATGTGAGGACGTTGTT GAAGGAGAAGGGTTTGAAGAAGGCTCCATGA
AA sequence Show only first row Show all	>Lus10002561 pacid=23165490 polypeptide=Lus10002561 locus=Lus10002561.g ID=Lus10002561.BGIv1.0 annot-version=v1.0 MPVEPDASIWRALLNGCRVGSDTEMAGSVFRNLVRLEPMNPGNYVLLANIYAAAGLWSDVRHVRTLLKEKGLKKAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24000			Tetratricopeptide repeat (TPR)...		Lus10002561 [exp]	0	1
AT2G40300		ATFER4	ferritin 4 (.1)		Lus10007523 [exp]	2.8	0.7905
AT3G49710			Pentatricopeptide repeat (PPR)...		Lus10006743 [exp]	5.5	0.7767
AT3G11591			unknown protein		Lus10032336 [exp]	6.4	0.7097
AT4G02750			Tetratricopeptide repeat (TPR)...		Lus10027365 [exp]	8.3	0.7863
AT4G11880	MADS	AGL14	AGAMOUS-like 14 (.1)		Lus10014144 [exp]	11.0	0.7914
AT3G03580			Tetratricopeptide repeat (TPR)...		Lus10004744 [exp]	15.8	0.7184
AT5G06430			Thioredoxin superfamily protei...		Lus10032763 [exp]	17.3	0.7390
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10006517 [exp]	18.0	0.7249
AT1G68320	MYB	BW62C, BW62B, A...	myb domain protein 62 (.1)		Lus10034338 [exp]	20.1	0.6948
AT3G55120		A11, CFI, TT5	TRANSPARENT TESTA 5, CHALCONE ...		Lus10030309 [exp]	25.7	0.7303

Compare expression of checked genes

Lus10002561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.