Lus10002563 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19855 179 / 3e-57 AtRbcX2 homologue of cyanobacterial RbcX 2, Chaperonin-like RbcX protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027363 328 / 2e-116 AT5G19855 200 / 1e-65 homologue of cyanobacterial RbcX 2, Chaperonin-like RbcX protein (.1)
Lus10030141 225 / 2e-75 AT5G19855 231 / 2e-77 homologue of cyanobacterial RbcX 2, Chaperonin-like RbcX protein (.1)
Lus10009941 224 / 5e-75 AT5G19855 221 / 1e-73 homologue of cyanobacterial RbcX 2, Chaperonin-like RbcX protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G258100 219 / 7e-73 AT5G19855 259 / 2e-88 homologue of cyanobacterial RbcX 2, Chaperonin-like RbcX protein (.1)
Potri.009G053300 214 / 7e-71 AT5G19855 230 / 4e-77 homologue of cyanobacterial RbcX 2, Chaperonin-like RbcX protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02341 RcbX RbcX protein
Representative CDS sequence
>Lus10002563 pacid=23165492 polypeptide=Lus10002563 locus=Lus10002563.g ID=Lus10002563.BGIv1.0 annot-version=v1.0
ATGGCAGGCGGTGCTGCTTTGCCTGGTACTTGTCTGTGCTTGGCAAGGTCGAGGAGGACTACCACTACATCAATGGTGGAGGTGGCTGCGAATACCGTGA
TTTGCAGAAGTAGCGGTCACTTTAGGAAGCAGCATCATCCGCAGAGGAGGGATCGCCGGAAGCTCGTCGCCGTTGCCAACCTCGGCGGGCAGTATGAGGA
TAGCTTCGGTGATGTTAAGTCGCAAATAGTGAACTTGTTTACGTTCAAGGCTGTGAGGACGGTTATGAACCAGCTTTATGAGATGAATCCAACTCAATAT
CGATGGTTTTACGATTTTGTTGCCAACAATAAGCCTGGAAATGGGAAGCTTTTCCTCCGAACCTTGGCCAAAGAGAGGCAAGACCTAGCTGAAAGAGTCA
TGGTGACTAGGCTTCATCTTTATGGAAAATGGATCAAGAAATGCAACCATGAGGAGATGTACAAGGCGATCTCGGACGAGAACTTGGAGTTGATGCGCGA
ACGGCTCCTAGAGACAGTGATTTGGCCATCGGACGACACCAACACCGAGAAGATCGGTTGA
AA sequence
>Lus10002563 pacid=23165492 polypeptide=Lus10002563 locus=Lus10002563.g ID=Lus10002563.BGIv1.0 annot-version=v1.0
MAGGAALPGTCLCLARSRRTTTTSMVEVAANTVICRSSGHFRKQHHPQRRDRRKLVAVANLGGQYEDSFGDVKSQIVNLFTFKAVRTVMNQLYEMNPTQY
RWFYDFVANNKPGNGKLFLRTLAKERQDLAERVMVTRLHLYGKWIKKCNHEEMYKAISDENLELMRERLLETVIWPSDDTNTEKIG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Lus10002563 0 1
AT1G07010 AtSLP1 Shewenella-like protein phosph... Lus10031284 1.0 0.9605
AT5G19855 AtRbcX2 homologue of cyanobacterial Rb... Lus10027363 1.4 0.9601
AT2G42975 unknown protein Lus10007332 2.0 0.9354
AT4G09350 NdhT, CRRJ NADH dehydrogenase-like comple... Lus10042771 4.2 0.9481
AT4G32590 2Fe-2S ferredoxin-like superfa... Lus10041038 6.7 0.9312
AT4G32590 2Fe-2S ferredoxin-like superfa... Lus10006189 6.7 0.9129
AT1G28140 unknown protein Lus10034291 7.5 0.9252
AT1G11090 alpha/beta-Hydrolases superfam... Lus10011212 9.6 0.8977
AT4G34350 HDR, CLB6, ISPH CHLOROPLAST BIOGENESIS 6, 4-hy... Lus10026322 9.8 0.9164
AT2G37240 Thioredoxin superfamily protei... Lus10014017 9.9 0.9267

Lus10002563 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.