Plant FIBer expression Database

Lus10002564 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17020 175 / 4e-54 transcription factor-related (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012849
[exp]
227 / 4e-74 AT4G17020 711 / 0.0 transcription factor-related (.1.2.3)
Lus10001212
[exp]
171 / 2e-51 AT3G09010 384 / 2e-128 Protein kinase superfamily protein (.1)
Lus10041753
[exp]
153 / 2e-49 AT4G17020 129 / 1e-36 transcription factor-related (.1.2.3)
Lus10005856
[exp]
77 / 2e-17 AT3G09010 279 / 6e-89 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G041600
[exp]
180 / 5e-56 AT4G17020 758 / 0.0 transcription factor-related (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03849 Tfb2 Transcription factor Tfb2
Representative CDS sequence
>Lus10002564 pacid=23160143 polypeptide=Lus10002564 locus=Lus10002564.g ID=Lus10002564.BGIv1.0 annot-version=v1.0
ATGCCTCAAGTAAAGATAATTGCGAAGAACTTCATGGGCATGGTGGCAGCTTTGCCCGCCATGAAACTCGATGTTCTCTACGAGAACTCATTCATTTGCG
AAGCCATTCTCAGGTCACTCCCGCCTCTGGCGAAGAAGTCCGTTATACAAATGCTATACATAGAAGGCTCCGTGACTGCTAAGTTATTGGAGGAGTGGGT
ACTTGCCAACGGTTTGACCAAGCACTTGGTCTACATTGATTGGTTGGTTCAGCTCAGAATCTTCACCGAAGCCGTTGAAAGGAAGAAGGAGAAATCCTAC
AGAATAAACCCAACTTTTCAGGCTAATCTCCAGAAGCATATAATGACCGGGTGA
AA sequence
>Lus10002564 pacid=23160143 polypeptide=Lus10002564 locus=Lus10002564.g ID=Lus10002564.BGIv1.0 annot-version=v1.0
MPQVKIIAKNFMGMVAALPAMKLDVLYENSFICEAILRSLPPLAKKSVIQMLYIEGSVTAKLLEEWVLANGLTKHLVYIDWLVQLRIFTEAVERKKEKSY
RINPTFQANLQKHIMTG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17020 transcription factor-related (... Lus10002564
[exp]
0 1
AT2G24820 AtTic55, TIC55-... translocon at the inner envelo... Lus10026246
[exp]
17.1 0.7405
AT4G39235 unknown protein Lus10021065
[exp]
28.3 0.7554
AT1G34190 NAC ANAC017 NAC domain containing protein ... Lus10006054
[exp]
29.5 0.7463
AT1G27000 Protein of unknown function (D... Lus10037210
[exp]
33.6 0.7446
AT1G24560 unknown protein Lus10029143
[exp]
40.5 0.7377
AT1G05600 EMB3101 EMBRYO DEFECTIVE 3101, Tetratr... Lus10002681
[exp]
59.0 0.7094
AT1G03650 Acyl-CoA N-acyltransferases (N... Lus10025567
[exp]
60.1 0.7000
AT5G53940 Yippee family putative zinc-bi... Lus10015416
[exp]
61.0 0.7241
AT5G07670 RNI-like superfamily protein (... Lus10031164
[exp]
108.5 0.6837
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10023188
[exp]
114.5 0.6991

Lus10002564 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.