Lus10002577 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28070 86 / 1e-21 AtCFL2 unknown protein
AT2G33510 66 / 4e-14 AtCFL1 unknown protein
AT3G52561 40 / 5e-05 unknown protein
AT3G11600 40 / 9e-05 unknown protein
AT5G06270 40 / 0.0001 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001804 184 / 6e-60 AT2G33510 145 / 8e-44 unknown protein
Lus10004209 44 / 2e-06 AT5G06270 100 / 4e-28 unknown protein
Lus10029413 44 / 2e-06 AT5G06270 100 / 4e-28 unknown protein
Lus10021305 44 / 3e-06 AT5G06270 122 / 8e-37 unknown protein
Lus10034181 43 / 9e-06 AT3G11600 87 / 3e-23 unknown protein
Lus10016982 42 / 1e-05 AT5G06270 122 / 4e-37 unknown protein
Lus10043404 42 / 3e-05 AT3G11600 78 / 1e-19 unknown protein
Lus10025524 40 / 0.0002 AT4G08910 49 / 4e-07 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G165800 103 / 1e-28 AT2G33510 162 / 7e-51 unknown protein
Potri.001G062000 97 / 6e-26 AT2G33510 152 / 4e-47 unknown protein
Potri.009G161400 43 / 5e-06 AT5G06270 91 / 9e-25 unknown protein
Potri.004G200300 41 / 4e-05 AT5G06270 71 / 7e-17 unknown protein
Potri.002G231400 41 / 6e-05 AT4G08910 54 / 4e-09 unknown protein
Potri.016G073400 40 / 9e-05 AT5G06270 115 / 2e-34 unknown protein
Potri.006G206000 40 / 0.0001 AT5G06270 108 / 8e-32 unknown protein
Potri.014G150900 39 / 0.0003 AT4G08910 49 / 3e-07 unknown protein
Potri.005G165300 39 / 0.0004 AT1G78170 124 / 4e-35 unknown protein
Potri.002G096100 39 / 0.0005 AT1G78170 119 / 3e-33 unknown protein
PFAM info
Representative CDS sequence
>Lus10002577 pacid=23160129 polypeptide=Lus10002577 locus=Lus10002577.g ID=Lus10002577.BGIv1.0 annot-version=v1.0
ATGCCTTACGACTGGGAACAATGCCTCGATTTAAAGACAGGGGAGATATACTACATGAACTGGAAGAATGGGATGAGAGCAAAGCATGATCCAAGGCTGC
TGCTAACACAAGACTTATTGATGAGTCGAGATCATGACTACAACAACTACAACTATTACTACTCAGATGAGGATGAGGATGATGATAGCTCATCCTGCGA
CAGTGAGGAGTCATCATCAGAGTCATCTCCTTGTTCCTCAAGAGACCATTTCAACAACAACAGTAGCATGATCAAGATAGTAGAAGACGAGGATGTGTTG
GTGGTAGCTGGATGCAAGAGATGCTTAATGTACTACATGCTCCCTAAGAAAGTTGACAATTGCCCACAATGCCGCGCCTCTCATCTTATTCACTTTGACA
GATCATCTGATAACAACAACAACACTGCTTGA
AA sequence
>Lus10002577 pacid=23160129 polypeptide=Lus10002577 locus=Lus10002577.g ID=Lus10002577.BGIv1.0 annot-version=v1.0
MPYDWEQCLDLKTGEIYYMNWKNGMRAKHDPRLLLTQDLLMSRDHDYNNYNYYYSDEDEDDDSSSCDSEESSSESSPCSSRDHFNNNSSMIKIVEDEDVL
VVAGCKRCLMYYMLPKKVDNCPQCRASHLIHFDRSSDNNNNTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G33510 AtCFL1 unknown protein Lus10002577 0 1
AT3G10490 NAC ANAC051, ANAC05... Arabidopsis NAC domain contain... Lus10037939 1.4 0.8737
AT2G33510 AtCFL1 unknown protein Lus10001804 2.8 0.9150
AT3G51670 SEC14 cytosolic factor family ... Lus10012219 3.0 0.8674
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10036914 4.2 0.8542
AT3G24860 Trihelix Homeodomain-like superfamily p... Lus10022789 5.1 0.8066
AT4G34160 CYCD3;1 CYCLIN D3;1 (.1) Lus10019825 9.6 0.8086
AT5G24318 O-Glycosyl hydrolases family 1... Lus10016032 10.4 0.8417
AT2G29380 HAI3 highly ABA-induced PP2C gene 3... Lus10003887 10.7 0.8140
AT1G51940 protein kinase family protein ... Lus10004625 11.1 0.7556
AT4G22570 APT3 adenine phosphoribosyl transfe... Lus10024612 14.5 0.8039

Lus10002577 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.