Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05130 96 / 4e-25 ATENT4 equilibrative nucleoside transporter 4 (.1) AT4G05120 94 / 4e-24 FUR1, ENT3, FLUOROURIDINEINSENSITIVE1, ATENT3 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) AT4G05110 92 / 1e-23 ATENT6 equilibrative nucleoside transporter 6 (.1) AT4G05140 91 / 5e-23 Nucleoside transporter family protein (.1) AT1G61630 89 / 2e-22 ATENT7 equilibrative nucleoside transporter 7 (.1) AT3G09990 79 / 1e-18 Nucleoside transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018414 [exp] 120 / 8e-34 AT4G05120 548 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10002589 [exp] 101 / 5e-27 AT4G05120 609 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10018413 [exp] 102 / 6e-27 AT4G05120 606 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10018523 [exp] 97 / 2e-25 AT4G05120 579 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10039741 [exp] 97 / 2e-25 AT4G05120 580 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Lus10020079 [exp] 94 / 2e-24 AT4G05120 392 / 7e-135 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G032500 [exp] 108 / 7e-30 AT4G05120 457 / 2e-160 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Potri.004G032400 [exp] 108 / 1e-29 AT4G05120 584 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Potri.004G032300 [exp] 103 / 1e-27 AT4G05120 586 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Potri.019G118400 [exp] 102 / 2e-27 AT4G05120 520 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1) Potri.011G041112 [exp] 99 / 4e-26 AT4G05120 540 / 0.0 FUDR RESISTANT 1, EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 3, Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002590 pacid=23177084 polypeptide=Lus10002590 locus=Lus10002590.g ID=Lus10002590.BGIv1.0 annot-version=v1.0 ATGGTCGAGCGCATCAAGCTGAAGTCGAGAAAGGGGCTAATGATCGTGACCCTAGCAAGGTTTTTGCTAGTTCCGGCCTTCTATTTCACGCCTACGTACG CAGATAAAGGTTGGATGATCGCTCTCACTTCGTTTCTCGGGTTAACAACTGGCTACCTCACTGTCTGTATCATGACCTTGGCTCCAAAGGGTTACAAGGC TAGTGATTTGATCACGGGAAATTTGTTTGTAAACCGGTATTGGTTAATCATGTAA
AA sequence Show only first row Show all	>Lus10002590 pacid=23177084 polypeptide=Lus10002590 locus=Lus10002590.g ID=Lus10002590.BGIv1.0 annot-version=v1.0 MVERIKLKSRKGLMIVTLARFLLVPAFYFTPTYADKGWMIALTSFLGLTTGYLTVCIMTLAPKGYKASDLITGNLFVNRYWLIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G05130		ATENT4	equilibrative nucleoside trans...		Lus10002590 [exp]	0	1
AT4G10850		SWEET7, AtSWEET...	Nodulin MtN3 family protein (....		Lus10023047 [exp]	4.1	0.9335
AT5G12060			Plant self-incompatibility pro...		Lus10023195 [exp]	5.8	0.9335
AT5G17600			RING/U-box superfamily protein...		Lus10008458 [exp]	7.1	0.9335
AT2G29040			Exostosin family protein (.1)		Lus10003440 [exp]	7.3	0.8659
AT4G29035			Plant self-incompatibility pro...		Lus10011895 [exp]	8.0	0.9319
AT5G42830			HXXXD-type acyl-transferase fa...		Lus10026686 [exp]	8.8	0.6380
AT4G35610	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10035994 [exp]	9.2	0.9316
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	10.1	0.9315
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10030505 [exp]	10.9	0.9307
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Lus10023022 [exp]	11.7	0.9292

Compare expression of checked genes

Lus10002590 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.