Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21445 155 / 1e-49 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018419 [exp] 186 / 3e-62 AT4G21445 152 / 2e-48 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G033400 [exp] 156 / 3e-50 AT4G21445 154 / 6e-49 unknown protein Potri.011G041800 [exp] 155 / 1e-49 AT4G21445 155 / 3e-49 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002594 pacid=23177092 polypeptide=Lus10002594 locus=Lus10002594.g ID=Lus10002594.BGIv1.0 annot-version=v1.0 ATGAACTCCTCTCTCAAACCTCATCTCCACCATCACCATCCATCATTCATCCTCTCCACTCCCATCACAACCCAAATCCACTTCTCCCCAATCGGTCAAC GAAAACCTCTCCGAATTCGATGCAGCAATGGCGAAAAGCGGAGCTTCCTGAGCCTCGAAGAAGCCGGCTTGGTCGAAGTCTCCGGCCTCAGCACTCACGA GAAGTTCCTCTGCCGCCTCACGATATCTTCGTTGAATCTGCTGAAGGTGATTTCGGAGCAGGAAGGGTGCGCCATTGAAGAGCTGAATGCTGGCAAAGTA TGCGACTGGTTCTTGAAGGATAAGCTTAAGAGAGAACAGAGTCTTGAATCTGCTGTTCTTCAGTGGGATGATTCTGATTTCCCCATTTGA
AA sequence Show only first row Show all	>Lus10002594 pacid=23177092 polypeptide=Lus10002594 locus=Lus10002594.g ID=Lus10002594.BGIv1.0 annot-version=v1.0 MNSSLKPHLHHHHPSFILSTPITTQIHFSPIGQRKPLRIRCSNGEKRSFLSLEEAGLVEVSGLSTHEKFLCRLTISSLNLLKVISEQEGCAIEELNAGKV CDWFLKDKLKREQSLESAVLQWDDSDFPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21445			unknown protein		Lus10002594 [exp]	0	1
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Lus10030091 [exp]	1.4	0.9726
AT5G19220		ADG2, APL1	ADP GLUCOSE PYROPHOSPHORYLASE ...		Lus10034053 [exp]	4.2	0.9585
AT4G31850		PGR3	proton gradient regulation 3 (...		Lus10026888 [exp]	4.9	0.9436
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Lus10005719 [exp]	4.9	0.9687
AT3G06670			binding (.1.2)		Lus10021547 [exp]	5.5	0.9560
AT3G44890		RP19, RPL9	ribosomal protein L9 (.1)		Lus10037372 [exp]	6.2	0.9660
AT5G66520			Tetratricopeptide repeat (TPR)...		Lus10014298 [exp]	7.5	0.9293
AT1G50900		LTD, GDC1	LHCP translocation defect, Gra...		Lus10011151 [exp]	8.4	0.9571
AT2G33450			Ribosomal L28 family (.1)		Lus10023747 [exp]	8.5	0.9637
AT4G29590			S-adenosyl-L-methionine-depend...		Lus10040550 [exp]	9.4	0.9567

Compare expression of checked genes

Lus10002594 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.