Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018421 [exp] 54 / 2e-11 ND 32 / 0.010
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10002596 pacid=23177087 polypeptide=Lus10002596 locus=Lus10002596.g ID=Lus10002596.BGIv1.0 annot-version=v1.0 ATGAGCTGCTCTGCTAAACTCCGGACAGATATCGGCAGCGTCTCCGGTGGAGACCACGGAGGAAACGCAGATGGGCGACGGATTTTCAACCGGAGCTCCG GTTCCGGCAAGAAAGGCGTTGAGGAAGAAGGGAGTAGGAAGAACAAACAGATTGAAGAGTCGTTGCAGAGAGTTATGTATTTCAACTGCTGGGCTCTTAG CTAA
AA sequence Show only first row Show all	>Lus10002596 pacid=23177087 polypeptide=Lus10002596 locus=Lus10002596.g ID=Lus10002596.BGIv1.0 annot-version=v1.0 MSCSAKLRTDIGSVSGGDHGGNADGRRIFNRSSGSGKKGVEEEGSRKNKQIEESLQRVMYFNCWALS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002596 [exp]	0	1
					Lus10018421 [exp]	1.4	0.9905
AT1G72360	AP2_ERF	AtERF73, HRE1	HYPOXIA RESPONSIVE ERF \(ETHYL...		Lus10008214 [exp]	2.4	0.9903
AT3G10920		MSD1, MEE33, AT...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10030534 [exp]	2.4	0.9883
AT3G50390			Transducin/WD40 repeat-like su...		Lus10016779 [exp]	3.5	0.9876
AT4G33070			Thiamine pyrophosphate depende...		Lus10015291 [exp]	3.6	0.9792
AT5G54960		PDC2	pyruvate decarboxylase-2 (.1)		Lus10005048 [exp]	3.9	0.9855
AT2G47430		CKI1	CYTOKININ-INDEPENDENT 1, Signa...		Lus10029849 [exp]	4.2	0.9852
AT1G77120		ADH1, ATADH, AT...	ARABIDOPSIS THALIANA ALCOHOL D...		Lus10029759 [exp]	5.3	0.9844
AT5G25940			early nodulin-related (.1)		Lus10030052 [exp]	6.3	0.9809
AT5G39890			Protein of unknown function (D...		Lus10003861 [exp]	7.1	0.9807

Compare expression of checked genes

Lus10002596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.