Lus10002623 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03773 166 / 1e-53 HSP20-like chaperones superfamily protein (.1.2)
AT4G02450 110 / 1e-30 HSP20-like chaperones superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020270 266 / 3e-88 AT5G55000 430 / 2e-149 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10010669 191 / 3e-63 AT3G03773 223 / 6e-76 HSP20-like chaperones superfamily protein (.1.2)
Lus10024119 114 / 1e-33 AT3G03773 121 / 2e-36 HSP20-like chaperones superfamily protein (.1.2)
Lus10000340 114 / 5e-32 AT4G02450 120 / 5e-34 HSP20-like chaperones superfamily protein (.1.2)
Lus10026136 114 / 8e-32 AT4G02450 122 / 1e-34 HSP20-like chaperones superfamily protein (.1.2)
Lus10008680 115 / 3e-31 AT5G04940 216 / 8e-64 SU(VAR)3-9 homolog 1 (.1), SU(VAR)3-9 homolog 1 (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G062600 180 / 3e-59 AT3G03773 191 / 3e-63 HSP20-like chaperones superfamily protein (.1.2)
Potri.019G038550 176 / 1e-57 AT3G03773 197 / 5e-66 HSP20-like chaperones superfamily protein (.1.2)
Potri.002G061500 111 / 7e-32 AT4G02450 123 / 4e-35 HSP20-like chaperones superfamily protein (.1.2)
Potri.005G199700 110 / 2e-31 AT4G02450 127 / 9e-37 HSP20-like chaperones superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF04969 CS CS domain
Representative CDS sequence
>Lus10002623 pacid=23168845 polypeptide=Lus10002623 locus=Lus10002623.g ID=Lus10002623.BGIv1.0 annot-version=v1.0
ATGGCGACGAGTTTTCTTCAATCTCCGGCCACAGCTCCGGCATCCGATAACAGCCATGAAGCAAGCCGGAATCCAGAAGTCCTCTGGGCGCAGAAATCCG
GCAAGGTGTACTTAACGATCGCCCTGCCGGACGCCAAGGATGTATCGGTGAAATGCGAGTCCGATGGCTTGTTCACCTTCTCAGCTCGCGGGATTCACGG
CGAGTCCTACGAGCTCAGTTTGCATCTCTACGCTCCGATTCTCCCCGAGACTTGTAAGGCGAATTGTGGATTGAGGAACATAATCTGCTCGATTCGGAAA
GCGGAGAAGAAATGGTGGGAGAGGCTGTTGAAGACTGGTGAGAAGCCTGCACCTTACATTAAGGTTGATTGGAGCAAGTGGATCGACGAGGATGATGAGG
ATTCAGCTTGTAAGTAG
AA sequence
>Lus10002623 pacid=23168845 polypeptide=Lus10002623 locus=Lus10002623.g ID=Lus10002623.BGIv1.0 annot-version=v1.0
MATSFLQSPATAPASDNSHEASRNPEVLWAQKSGKVYLTIALPDAKDVSVKCESDGLFTFSARGIHGESYELSLHLYAPILPETCKANCGLRNIICSIRK
AEKKWWERLLKTGEKPAPYIKVDWSKWIDEDDEDSACK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G03773 HSP20-like chaperones superfam... Lus10002623 0 1
AT4G14640 CAM8, AtCML8 calmodulin-like 8, calmodulin ... Lus10004088 1.0 0.9176
AT5G47450 ATTIP2;3, DELTA... DELTA-TONOPLAST INTRINSIC PROT... Lus10007796 5.7 0.9176
AT1G11655 unknown protein Lus10001141 5.9 0.8995
AT5G42630 GARP KAN4, KANADI4, ... KANADI 4, ABERRANT TESTA SHAPE... Lus10032746 8.1 0.8987
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10025068 11.5 0.9087
AT5G47450 ATTIP2;3, DELTA... DELTA-TONOPLAST INTRINSIC PROT... Lus10004733 12.7 0.8985
AT5G23660 MTN3, SWEET12, ... homolog of Medicago truncatula... Lus10009782 13.5 0.8817
AT3G14590 NTMCTYPE6.2 ,NT... Calcium-dependent lipid-bindin... Lus10042475 16.2 0.8828
AT4G23885 unknown protein Lus10001827 16.3 0.8801
AT4G25050 ACP4 acyl carrier protein 4 (.1.2) Lus10018986 17.0 0.8981

Lus10002623 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.