Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G33340 87 / 3e-20 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) AT1G31450 86 / 6e-20 Eukaryotic aspartyl protease family protein (.1) AT2G03200 85 / 2e-19 Eukaryotic aspartyl protease family protein (.1) AT3G61820 83 / 1e-18 Eukaryotic aspartyl protease family protein (.1) AT1G64830 82 / 1e-18 Eukaryotic aspartyl protease family protein (.1) AT2G35615 81 / 4e-18 Eukaryotic aspartyl protease family protein (.1) AT2G28010 81 / 6e-18 Eukaryotic aspartyl protease family protein (.1) AT1G01300 80 / 2e-17 Eukaryotic aspartyl protease family protein (.1) AT3G20015 79 / 4e-17 Eukaryotic aspartyl protease family protein (.1) AT2G28040 76 / 3e-16 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002612 [exp] 94 / 1e-22 AT5G33340 393 / 5e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10002611 [exp] 94 / 2e-22 AT5G33340 392 / 9e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10002613 [exp] 94 / 2e-22 AT5G33340 406 / 4e-139 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10018825 [exp] 93 / 3e-22 AT5G33340 432 / 1e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024903 [exp] 91 / 2e-21 AT5G33340 449 / 3e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10022917 [exp] 90 / 2e-21 AT2G03200 194 / 2e-58 Eukaryotic aspartyl protease family protein (.1) Lus10022912 [exp] 90 / 3e-21 AT5G33340 450 / 1e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024910 [exp] 90 / 3e-21 AT5G33340 452 / 2e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10041150 [exp] 86 / 1e-19 AT5G33340 399 / 2e-137 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G087900 [exp] 87 / 3e-20 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.014G114400 [exp] 84 / 3e-19 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.019G002100 [exp] 81 / 4e-18 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.014G099400 [exp] 81 / 6e-18 AT1G01300 633 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.005G063000 [exp] 78 / 7e-17 AT3G20015 560 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.003G105300 [exp] 77 / 9e-17 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1) Potri.001G306200 [exp] 77 / 1e-16 AT2G03200 501 / 1e-176 Eukaryotic aspartyl protease family protein (.1) Potri.002G171700 [exp] 77 / 1e-16 AT1G01300 642 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.007G106300 [exp] 77 / 2e-16 AT3G20015 575 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.015G051800 [exp] 76 / 6e-16 AT3G18490 585 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0129 [flax] [poplar] Peptidase_AA PF00026 [flax] [poplar] Asp Eukaryotic aspartyl protease
Representative CDS sequence Show only first row Show all	>Lus10002630 pacid=23168853 polypeptide=Lus10002630 locus=Lus10002630.g ID=Lus10002630.BGIv1.0 annot-version=v1.0 ATGAGCTTTCCAATTGTTATCTTCCTTCTTAGTTCACTAATTTGTCCAACATCACTTGCTATACCAACAACCAAAAGTAGTACTAAGACCATCACCCTTG ACCTAACCCACAAGTATTCATTCTTGTCCCATACCCAATACTACAACCGGTTAACCGACTTGTTACGACGTTCGATACACCGTGTCAACCGACTGATGAA TTCTTCTGGTGGGTTGAGTATCGGCCCTGTAATAACGTTACTCCCGGGCGACGGAGACTACCTCATGAAGATATCTATCGGCACCCCGCCGGTGGGCATC TACGCCGCCCTCGATACGAGGAGCGACCTGGTATGGACGCAGTGCAAGTCGTGCATCGTGTGTTTCGACCAGAACGACCCTTACTACGACCCGTCCAACT CATCGACTTACGCCCCCTTGTCGTGCGACTCGCCTTTGTGCTACCCTAGCTTACACGACGCCAGCAGTTCATTCTCGAGCCTGGCCACTGCCTGCTCGAA CGGCTCGCGTTTCTACTTTCAATTTCTACTTCCAAAGAGAAGGCCCATTCCTGACAGATGGCATCCTCGCCACTGA
AA sequence Show only first row Show all	>Lus10002630 pacid=23168853 polypeptide=Lus10002630 locus=Lus10002630.g ID=Lus10002630.BGIv1.0 annot-version=v1.0 MSFPIVIFLLSSLICPTSLAIPTTKSSTKTITLDLTHKYSFLSHTQYYNRLTDLLRRSIHRVNRLMNSSGGLSIGPVITLLPGDGDYLMKISIGTPPVGI YAALDTRSDLVWTQCKSCIVCFDQNDPYYDPSNSSTYAPLSCDSPLCYPSLHDASSSFSSLATACSNGSRFYFQFLLPKRRPIPDRWHPRH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G31450			Eukaryotic aspartyl protease f...		Lus10002630 [exp]	0	1
AT3G52490			Double Clp-N motif-containing ...		Lus10042638 [exp]	1.0	0.9975
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	3.5	0.9817
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	4.2	0.9817
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	4.9	0.9817
					Lus10033096 [exp]	5.5	0.9817
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	6.0	0.9743
AT1G79500		ATKDSA1, KDSA	Aldolase-type TIM barrel famil...		Lus10027741 [exp]	6.2	0.7864
AT2G28085			SAUR-like auxin-responsive pro...		Lus10041336 [exp]	6.3	0.7840
AT3G44150			unknown protein		Lus10021005 [exp]	7.0	0.9647
AT5G63920		TOP3A, AtTOP3al...	topoisomerase 3alpha (.1)		Lus10006779 [exp]	7.5	0.9610

Compare expression of checked genes

Lus10002630 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.