Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70850 58 / 1e-11 MLP34 MLP-like protein 34 (.1.2.3) AT1G70890 55 / 3e-11 MLP43 MLP-like protein 43 (.1) AT1G70830 55 / 3e-11 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT1G70840 52 / 4e-10 MLP31 MLP-like protein 31 (.1) AT5G28010 52 / 4e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70880 50 / 2e-09 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70860 44 / 1e-07 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2) AT5G28000 42 / 3e-06 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G14930 38 / 7e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70870 37 / 0.0001 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012742 [exp] 121 / 4e-37 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5) Lus10020498 [exp] 117 / 1e-35 AT1G70830 160 / 7e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10012466 [exp] 114 / 2e-34 AT1G70830 161 / 3e-51 MLP-like protein 28 (.1.2.3.4.5) Lus10020497 [exp] 69 / 2e-16 AT1G70840 148 / 4e-46 MLP-like protein 31 (.1) Lus10012467 [exp] 62 / 5e-14 AT1G70890 80 / 5e-21 MLP-like protein 43 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G111000 [exp] 76 / 3e-19 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5) Potri.017G051100 [exp] 54 / 5e-11 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1) Potri.017G051200 [exp] 53 / 1e-10 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.008G131300 [exp] 42 / 3e-06 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131200 [exp] 41 / 5e-06 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.008G131100 [exp] 35 / 0.0009 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10002644 pacid=23168803 polypeptide=Lus10002644 locus=Lus10002644.g ID=Lus10002644.BGIv1.0 annot-version=v1.0 ATGAAGGAGTACAAGAACTTCAAGATTGTGGTTAAGGCCACTCCGCAGAAGAAGACTGAAGGAGAAGGCTGGTGTCTGGTTCACTGGGTCGTGGACTACG AACAGCTCAAAGAGGAAACCCCAGAACCTTTCTCCCTTCTCGCATTTGCGGTTCACATGAGCAAAGACATCGACGATCATCACACTAAGAACTGA
AA sequence Show only first row Show all	>Lus10002644 pacid=23168803 polypeptide=Lus10002644 locus=Lus10002644.g ID=Lus10002644.BGIv1.0 annot-version=v1.0 MKEYKNFKIVVKATPQKKTEGEGWCLVHWVVDYEQLKEETPEPFSLLAFAVHMSKDIDDHHTKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G70850		MLP34	MLP-like protein 34 (.1.2.3)		Lus10002644 [exp]	0	1
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10011986 [exp]	1.7	0.9654
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10033581 [exp]	2.8	0.9488
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10033582 [exp]	5.5	0.9311
AT1G62935			unknown protein		Lus10009297 [exp]	6.0	0.9183
AT1G60500		DRP4C	Dynamin related protein 4C (.1...		Lus10025903 [exp]	6.0	0.9444
AT1G20870			HSP20-like chaperones superfam...		Lus10007642 [exp]	6.6	0.9397
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10010765 [exp]	7.1	0.8987
					Lus10008321 [exp]	8.2	0.8838
AT1G68630			PLAC8 family protein (.1)		Lus10009036 [exp]	9.9	0.9029
					Lus10002237 [exp]	10.4	0.8958

Compare expression of checked genes

Lus10002644 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.